Update README.md

README.md

@@ -1,4 +1,4 @@
-#Install
+# Install
     
     conda create -n druggpt python=3.7
     conda activate druggpt
@@ -9,21 +9,21 @@
     pip install scipy scikit-learn
     conda install -c openbabel openbabel
 
-#How to use
+# How to use
 
-    Download the drug_generator.py file and bcl2.fasta.
-    Activate the druggpt environment using conda activate druggpt.
-    Navigate to the directory containing the drug_generator.py file using cd path/to/directory.
-    Run the script with the desired arguments, such as the protein sequence, ligand prompt, number of molecules to generate, and output directory.
+1.Download the drug_generator.py file and bcl2.fasta.
+2.Activate the druggpt environment using conda activate druggpt.
+3.Navigate to the directory containing the drug_generator.py file using cd path/to/directory.
+4.Run the script with the desired arguments, such as the protein sequence, ligand prompt, number of molecules to generate, and output directory.
 
-#Example usage:
+# Example usage:
     
-    ##If you want to input a protein FASTA file,
+## If you want to input a protein FASTA file,
     python drug_generator.py -f bcl2.fasta -n 50
     
-    ##If you want to input the amino acid sequence of the protein,
+## If you want to input the amino acid sequence of the protein,
     python drug_generator.py -p MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH -n 50
     
-    ##If you want to provide a prompt for the ligand
+## If you want to provide a prompt for the ligand
     python drug_generator.py -f bcl2.fasta -l COc1ccc(cc1)C(=O) -n 50