Dataset Viewer
Auto-converted to Parquet
text
stringlengths
13
3.7k
meta
dict
j. j. abrams returns to write and direct'star wars : episode ix'09 / 12 / 2017 11 : 11 am et updated sep 12, 2017 the return of the j. j. by bill bradley update : 4 : 00 p. m. et โ€” in addition to the director news, " star wars " announced that the premiere date for " episode ix " will be dec. 20, 2019. star wars : episode ix is scheduled for release on december 20, 2019. pic. twitter. com / rdbqmuhx89 โ€” star wars ( @ starwars ) september 12, 2017 the force was with j. j. abrams when he launched the new set of " star wars " films with " the force awakens, " so now disney is bringing him back. as deadline reported on tuesday, and according to a press release on starwars. com, abrams will return to write and direct " star wars : episode ix. " the statement reads : a post shared by star wars ( @ starwars ) on sep 12, 2017 at 7 : 28am pdt after disney unexpectedly parted ways with former " episode ix " director colin trevorrow earlier this month, rumors that rian johnson, who is directing " star wars : the last jedi, " would take over surfaced. but deadline reports that johnson decided not to take the offer to direct. on abrams'hiring, lucasfilm president kathleen kennedy said, " with'the force awakens,'j. j. delivered everything we could have possibly hoped for, and i am so excited that he is coming back to close out this trilogy. " after what we saw in " force awakens, " we're pretty excited about it, too. we just hope they call it " the return of the j. j. " there were 2 royal moments you might have missed at biden's inauguration joe biden removed trump's diet coke button, twitter bubbled up with jokes princess charlene defends new buzzcut hairstyle :'it was my decision'katy perry closes out biden's inauguration celebration with a literal bang'star wars'postage stamps entertainment editor, huffpost movies star wars j. j. abrams
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
hire event staffing in barrie, ontario and discover how push agency can help you create the right brand perception and increase exposure. barrie, on โ€“ looking for a superior staff that will increase sales? push has your solution. our revolutionary live marketing tactics provide our clients with the very best the industry can offer. clients are given access to an array of amenities enhancing their experience with us. push works around the clock to ensure that your event goes off without a hitch. each client gets access to set up our database to tailor their needs. they are able to set up their very own user console to review events, select models, set up trainings, and so much more. give us a call when planning your next barrie area event to learn how a little push can make a big impact!
{ "redpajama_set_name": "RedPajamaC4" }
pascal pictures movie review : spider - man : no way home ( 2021 ) vincent gaine the balance between innovation and homage is a difficult one to strike. this is especially so when dealing with established and beloved properties. spider - man : no way home takes on the formidable task of balancing the demands of a standalone film, the marvel cinematic universe ( mcu ), and the wider presence of spider - man in cinema and popular โ€ฆ movie review : little women ( 2019 ) howard schumann writer / director greta gerwig ( " lady bird " ) puts a contemporary spin on louisa may alcott's nineteenth century classic novel in little women, now in its eight film version. alcott's semi - autobiographical story about four sisters growing up in concord, massachusetts during and after the civil war stands out for its warmth and celebration of family, its exquisite period โ€ฆ movie review : spider - man : into the spider - verse ( 2018 ) floyd smith iii when sony announced its plans for a theatrical release of an animated spider - man film, even hardcore fans of the web swinger may have considered it to be just another unwarranted adaptation. " haven't we seen enough portrayals of spider - man?, " those with comic - book movie fatigue asked, and yet in his seventh major solo theatrical release since 2002, โ€ฆ movie review : the post ( 2017 ) if the post was little more than a piece of agitprop beating the drums for the value of a free press in a democracy, it would more than justify its reason for being. the fact that it is so much more is a testament to the skills of director steven spielberg and the talents of โ€ฆ movie review : molly's game ( 2017 ) joe kotisso since his screenwriting breakthrough with " a few good men, " aaron sorkin has crafted himself an illustrious hollywood career, which includes a nomination for the best adapted screenplay oscar for " moneyball " and a win for the same for " the social network " as well as earning multiple emmy awards for his work on the landmark tv series โ€ฆ movie review : spider - man : homecoming ( 2017 ) for many a superhero fan, whether in comic books, television or movie format, spider - man is likely to be a childhood favorite. stan lee and steve ditko's creation of a nerdy teenager who acquires the abilities of a spider has struck nerves ( or web strands ) with multiple generations, as peter parker's struggles with his new powers โ€ฆ movie trailer # 2 : spider - man :
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
lej assassination tango hos itunes for 39 kr. john j. ( robert duvall ) is a seasoned hit man sent on a job to argentina. when the general he's sent to kill delays his return to the country, john passes the time with manuela ( luciana pedraza ), a beautiful dancer who becomes his teacher and guide into argentina's sensual world of the tango. spellbound by the rich and mysterious world manuela has shown him, his idyll is shattered when the reality of why he's there comes crashing down around him.
{ "redpajama_set_name": "RedPajamaC4" }
cba legal challenge heads to b. c. court of appeal by david weir | june 26th, 2020 | advocacy, community benefits agreement | the construction industry partners challenging b. c.'s community benefits agreement ( cba ) will be in court july 16 and 17 to appeal the b. c. supreme court ruling that stalled the judicial review last february. the b. c. court of appeal will be asked to overturn supreme court justice christopher giaschi's decision striking portions of the petition for [... ] cba update โ€“ bcib publishes updated faq by david weir | march 2nd, 2020 | advocacy, community benefits agreement, in the news | contractors wanting to understand how b. c.'s community benefit agreement ( cba ) will be applied may find the answers they need in an updated contractor & subcontractor q and a document produced by b. c. infrastructure benefits inc. ( bcib ). the updated q & a, which was posted recently to a redesigned bcib website, provides answers to several questions vrca [... ] vrca attends rally demanding government stops the cba roll - out by david weir | november 22nd, 2019 | advocacy, community benefits agreement, in the news | the vancouver regional construction association ( vrca ) joined industry representatives and progressive labour unions at the b. c. legislature on november 19 to demand the provincial government stop the roll - out of its prescriptive and regressive community benefits agreement ( cba ), introduced in july 2018. " our industry is deeply offended at the lack of industry engagement that took [... ] community benefits agreement and regional advocacy the focus at november division meetings by david weir | october 21st, 2019 | advocacy, community benefits agreement, general contractors, manufacturers & suppliers, trade contractors | the provincial government policy requiring key infrastructure projects to be built using the community benefits agreement ( cba ) framework continues to be one of the top issues worrying b. c.'s construction industry. join us at division meetings in november to get an update on : the legal challenge to the cba brought by vrca and its industry [... ] separating fact from fake on the b. c government's infrastructure deal by david weir | january 21st, 2019 | advocacy, community benefits agreement, in the news | do you support forcing the canucks to play with half of their own players while having the other half assigned to them at game time? we suspect few would agree to such a proposal, yet that's
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
the andreas [ dot ] humm unifr [ dot ] ch ( program coordinator ) to receive information about the joint master's program. holders of a bachelor's degree in computer science from a university of applied sciences ( with, in principle, a grade average of at least 5. 0 in their bachelor studies ), or holders of a different type of university degree ( in particular holders of a bachelor degree with a minor in computer science ) can also submit an application to the matriculation services for consideration for admission. in such cases, the applications are considered on a case by case basis and the branch committee may require the applicant to earn additional ects credits ( a maximum of 60 ) from courses at the bachelor's level in a so - called " complement to the master program ". the goal of the complement to the master program is to complete the knowledge and skills of the previous studies to be prepared to the master program. the complement to the master program is usually composed by courses at the bachelor's level in computer science and / or mathematics. the total number of credits that have to be earned in the complement to the master program and the exact list of courses ( individual study plan ) are defined by the branch committee on a case by case basis at the moment of treating the request for admission of the candidate. these credits can be acquired in parallel to the master studies but before starting the master thesis. since courses are mainly taught in english, sometimes also in french or german, knowledge of english is required ; knowledge of french or german is a plus. independent which home university a student chooses, an admission request ( from an academic point of view ) is only treated once by the same competent authority, the branch committee. these deadlines do not apply for students who are already registered for a program at one of the benefri universities.
{ "redpajama_set_name": "RedPajamaC4" }
a tribute to late professor mahlagha ghorbanli this edition of ijpp celebrates ten years of steady publication of iranian journal of plant physiology. the story of ijpp is that of a journey that started from a local forum where the researchers and scholars mainly from the islamic azad university could share findings of their studies, gradually developing into an international peer - reviewed journal indexed by islamic world science citation center ( https : / / isc. gov. ir / en ) and scimago journal & country rank ( www. scimagojr. com ). we heartily appreciate numerous authors, both local and international, whose contributions have led us reach this far and look forward to more original research reports to move even further. this edition is dedicated to late mahlagha ghorbanli, the emerita full professor of plant physiology in kharazmi university, the first institution for teacher education in iran. with her broad range of expertise and comprehensive knowledge of various research avenues in the field of plant physiology combined with a warm, caring, and supportive personality, professor ghorbanli was the first editor - in - chief of ijpp, a prominent figure who was able to lead the editorial board of ijpp through the challenges inherent in starting a scientific journal. we owe much of what we have achieved to her scholarship and visions. may her soul rest in peace! iranian journal of plant physiology ( 2020 ). a tribute to late professor mahlagha ghorbanli. iranian journal of plant physiology, 11 ( 1 ), -.. " a tribute to late professor mahlagha ghorbanli ". iranian journal of plant physiology, 11, 1, 2020, -. ( 2020 ).'a tribute to late professor mahlagha ghorbanli ', iranian journal of plant physiology, 11 ( 1 ), pp. -. a tribute to late professor mahlagha ghorbanli. iranian journal of plant physiology, 2020 ; 11 ( 1 ) : -.
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
mass. medical, dental societies call for professional judgment in pain control susan spencer telegram & gazette staff massachusetts medical society and massachusetts dental society representatives say they're concerned about the misuse of prescribed medications, but also call for regulatory balance that allows prescribers to use their professional judgment to provide care that's best for patients. " one of the unintended consequences is where you're so regulated, you're afraid to prescribe and people won't get the pain medication they need, " said dr. ronald w. dunlap, a cardiologist and president of the medical society. " we all have different pain thresholds. some people have terrible pain. " dr. dunlap said the medical society was working with regulators to make the state department of public health's prescription monitoring program, a database of controlled substance prescriptions, less burdensome to use. he also said pharmacy chains have extensive databases that could be used with dph's data to identify providers who prescribe a large number of opioids. dr. thomas trowbridge, an oral surgeon in lowell and a trustee of the dental society, said, " it's in our interest to promote the patient's appropriate amount of pain control. " he said adequately controlling pain hastens the healing process and helps patients get back to work or school. the amount of medication needed varies by the weight and age of the patient, the procedure performed and other factors. dr. trowbridge said that anecdotes about young people receiving large vicodin or percocet prescriptions after having their wisdom teeth removed needed to be taken in context. " often times it will be the first time for surgery where they've had to have pain control, " dr. trowbridge said. but also, many people who don't share their anecdotes have wisdom teeth removed without notable post - surgery prescriptions, large or small. " if we give them too few, it's been harder to call in more prescriptions, " dr. trowbridge said, particularly for schedule ii drugs including percocet and oxycontin, which in massachusetts cannot be phoned in to the pharmacy. " it's always good to have enough medicine ahead of time and prepare them for recovery. "
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
the new u. s. national defense strategy : a " good deal " for the military - industrial complex feb 9th, 2018 + in this article : defense, military strategy, politics, society, united states, war on january 19, 2018, u. s. secretary of defense james mattis presented in washington the declassified version of the united states'national defense strategy. in his speech, he made clear the militaristic approach that will be maintained in coming years : " this strategy expands our competitive space, prioritizes preparedness for war. " according to mattis, the fight against terrorism will continue, " but great power competition, not terrorism, is now the primary focus of u. s. national security, " which means a readjustment of the approach since the attacks of september 11, 2001. in line with the national security strategy of december 2017, russia and china are identified as the main threats to the u. s. on a second level, are the democratic people's republic of korea and iran, and the most dangerous non - state actor is identified as the islamic state. the document notes, " the 2018 national defense strategy underpins our planned fiscal year 2019 - 2023 budgets, accelerating our modernization programs and devoting additional resources in a sustained effort to solidify our competitive advantage. " in this sense, the u. s. will prioritize nuclear modernization, and investments in cyber and missile defense. this the first time, in more than 15 years, that the u. s. has explicitly stated its interest in increasing military spending to maintain superiority over russia and china, and consolidate its global hegemony. during this period, international terrorism served as the pretext for the strengthening of u. s. military forces, since after the fall of the soviet union and the socialist camp, the supposed threat that led the united states to exponentially increase its military budget after wwii, to the benefit of influential corporations, disappeared. the language used recalls the cold war era east - west conflict. the greatest exponent of the arms race was president ronald reagan, who in 1983 publicly launched the strategic defense initiative, in which the scientific community was asked to develop a missile defense system to guarantee the protection of u. s. territory against a nuclear attack. it was also known as " star wars, " like the famous film of the time. as was shown that on that occasion, the only winner was " the military - industrial complex. " the current strategy also reaffirms that the use of force
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
reader reviews and comments on academy street, plus links to write your own review. academy street is the first novel by irish author, mary costello. it chronicles the life of teresa lohan, from her youth in rural ireland in the 1940s through her time in new york and her return to ireland in her sixties. tess is seemingly unremarkable, both as a child and an adult : a shy, sensitive child ; a woman with an essential loneliness ( " it seemed at times that she was marooned on an island, a moat of water, wide and black, separating her from all human love. " ) ; a mother who feels she could have done better. nonetheless, costello's exquisite prose conveys this life with such emotion, such care, that the reader cannot help but be moved. costello paints her character so vividly, so completely, that the reader can identify with tess, her feelings ( " โ€ฆ the mark of all anxiety : the acute awareness of the endless possibilities that can simultaneously imperil and enhance us, and all that might be lost or gained. " ), her ideas ( " it ireland seemed to her now to be a place without dreams, or where dreaming was prohibited. here, life could be lived at a higher, truer pitch. though her own was a timid life, there was, since theo's birth, a yearning towards motion and spirit and vitality. " ), her reactions ( " she thought of the water that had lain quietly calm, each tiny drop, each molecule, restful, suddenly wrenched, catapulted through a metal rotary, tossed back out into the turbulent current, reeling, confounded, changed. " ). in both style and content, this novel is reminiscent of sebastian barry's work, in particular, " on canaan's side ". a remarkable debut novel.
{ "redpajama_set_name": "RedPajamaC4" }
the luxury suites all face the mountain and have balconies providing a panoramic view of the area. double, single, and family suites are available ( see below ). the two double suites consist of a bedroom and living room, both with their own bathroom. the family suite has en - suite bathrooms and share a living room with kitchenette. both double suites, as well as the family suite have a comfortable sleeper couch for children. braai facilities are available and abbaqua has a large relaxation lounge where you can sit back and make yourself at home. book online now and experience the vacation you deserve! bedroom - 2 single beds ( can be converted to a king size bed ) and bathroom. lounge area with double sleeper couches and kitchenette. two bedrooms, each with own en - suite bathroom. shared lounge area - kitchenette and double sleeper couch. this luxury cottage has a double bed with en suite bathroom, kitchen and private braai facilities.
{ "redpajama_set_name": "RedPajamaC4" }
i love the sounds of jerusalem. the voices, noises, and music all tell stories that are unparalleled in the jewish world โ€“ and perhaps in the world at large. one i find so compelling is that of my story and the story of the " other, " which i hear simultaneously. there a variety of others in jerusalem โ€“ arabic, russian, amharic, yiddish, and hebrew โ€“ and over the course of a week, i can listen and hear these voices and countless more. it is one of the incredible characteristics of our city. join me on a brief tour of some of the other voices i am so fortunate to hear regularly in jerusalem. saruat shared her voice honestly and directly, telling us she came to hebrew university intent on learning, but determined never to interact with jewish israelis. it was a harsh message. hearing about the challenges she faces as a person without a country was painful, too. but, we were inspired by the story of the journey that led saruat to seek out interactions with jewish israelis. at urj heller high, we make sure students have ample opportunities to hear voices of others whom they may not otherwise encounter. when they learn about contemporary jewry, they meet an ultra - orthodox couple ( and representatives of other streams of judaism ). the encounter may be the only time students have the chance to listen to haredi jews talk about what they believe and represent, and how they are different from other jews we may know. it's important for students โ€“ and all of us โ€“ to listen with an open mind to people who express theological, philosophical, and practical opinions that are completely foreign to them and often contradict their own deeply held beliefs. almost every semester, our ultra - orthodox guests stay well past the allotted time to answer students'many questions. erev shabbat, friday night, at the western wall ( the kotel ) is the time and place to hear your own voice and those of others at the same time. two weeks ago, we were at the egalitarian kotel for the first kabbalat shabbat service of the semester. just as we started our service, the muezzin ( muslim prayer leader ) started chanting the call to prayer over the loudspeakers of the al aqsa mosque on the temple mount, and the middle eastern music echoed throughout the kotel plaza. at the same time, a group of yeshiva students began their kabbalat shabbat prayers which rebounded off the kotel and into the area
{ "redpajama_set_name": "RedPajamaC4" }
when you have an event, and you are expecting a lot of people example for a wedding then you will need a corporate catering company that will help you by ensuring that your guests leave the place when they have enjoyed the food. the food and drinks that are always in ceremonies are of importance because the people attending the party will not have to leave early as they will be sorted out in the right manner. the corporate catering company will be able to attain that if they are experienced, and they can know the amount to be serving in case they notice the amount of food and the number of people are not adding up. if you have no idea of where to find corporate catering company then you can ask around from people or companies where they get their caterers from. you will have saved yourself some time and energy. when you search online, you will get a lot of information about different corporate catering companies. the following are some of the things that you should be added when searching for a corporate catering company. it should be one made of a team that is experienced. the right one to choose is the one that is well experienced as you will be at peace with them. the corporate catering company should be one that takes hygiene seriously because if they mess, then they will have messed up a big congregation. it should be an independent corporate catering company that has their things. that will make them seem focused on what they are doing. they should also have excellent communication skills so that they can relate well with the people in the event. it should be a caring catering team that provides that everyone has been served. that is the best way to go about it because that is how people will end up like their services. the corporate catering company should have an idea of how surprises go about. they can come up with their way of surprising the guests. it difficult to get such a company but they are there. it should be known by a lot of people around the city. you will be able to know that once you interview a few people around the area. you can as well ask the people who have worked with them as they will tell you according to their view. it will be better when you go to the one that a friend has advised you because they might have had an experience with it. that is because of the excellent job they do once they have been asked to make a meal and serve the guests. the corporate catering company must be providing quality services.
{ "redpajama_set_name": "RedPajamaC4" }
karen napier, director while studying dance, karen grew weary of seeing christianity removed from the art, and vowed to provide a place where christian dancers could study classical ballet and other dance arts in a god - glorifying manner. this became the audience of one dance studio. our mission is to always dance in god's honor, whether in our studio classroom or a national ballet competition. mrs. karen reared her daughters in a dancing home, and it is a joy to have them now teaching for her, in this family dance ministry. monica halvorson monica is a proud graduate of florida state university. she has been on staff with us for 12 years and is known throughout the dance community for her creative contemporary and jazz pieces. her students have received numerous top awards at regional and national dance competitions, and she is often complimented by dance judges for thinking " outside of the box ". monica works with our upper elementary, high school and college dancers and enjoys fine tuning their technique to create a versatile, well - rounded dancer. her goal is to inspire her students to express themselves through their movement, and to be a positive role model for each student. monica teaches elementary jazz & acrobats, as well as advanced tap, jazz and contemporary. roxanne rich roxanne has been taking dance since she was 2 years old and has been an instructor with audience of one dance since she was 16. she received her dance training from our studio and is known for her talents as a dancer and choreographer. roxanne is also a principal dancer of the redeemer dance company as well as a professional aerialist. her goal is that her passion for dance will be contagious and continue in her students. roxanne is a proud fsu graduate and is a licensed physical therapist assistant. roxanne teaches advanced hip hop and our stretch and condition class. laura odom laura is 24 years old and a panama city native. she holds her associate of science degree from gulf coast state college and is a licensed physical therapist assistant. laura has been dancing since 2000 and has been teaching for audience of one since 2013. she has trained heavily in classical ballet and continues her dance education yearly. laura regularly attends technique classes and often participates in alabama dance theatre's summer dance intensive under the instruction of american ballet theatre's former prima ballerina shawn black. although laura's first love is ballet, she equally enjoys contemporary and jazz. she desires for all of her students to build a solid foundation of good technique, and hopes that her classes
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
santander extends shared parental leave to grandparents santander, which employs around 600 people in glasgow, has been judged one of the times top 100 graduate employers for 2016 - 17. the prestigious rankings, now in their eighteenth year, are based on research among more than 18, 300 final year students who left university this year. the students are asked which employers they feel offer the best opportunities for graduates, with the feedback used to compile the top 100 list. santander is the highest newcomer to the awards, and the bank of england is the biggest climber. iain gallagher, emerging talent senior manager at santander, said : " we're delighted to be included in the times top 100 graduate employers and even more so because it's feedback directly from the graduates themselves. it's really important for us to appeal to young talent from all walks of life, so it's great that we've been rated so highly by uk graduates. " scott reeves, graduate relationship manager, joined santander in glasgow having graduated from university of edinburgh this summer. he said : " i'm seeing first - hand the opportunities santander offers graduates and these drew me to the bank in the first instance. there is a wide variety of career paths open to people joining the bank and santander's commitment to ensuring you develop throughout your career means there are lots of opportunities as you progress. " the times top 100 graduate employers has been compiled from research with 18, 353 final year students who left university in the summer of 2016 and is published as a full - colour hard - backed book. 60, 000 copies are distributed free - of - charge to undergraduates through local careers services at fifty leading universities. sarah webster at santander tel : 020 7756 5533 mob : 07568112529 the press office operates from 8. 00am to 6. 00pm. outside of these hours please call 0800 5877708. santander uk is a financial services provider in the uk that offers a wide range of personal and commercial financial products and services. it has brought real competition to the uk, through its innovative products for retail customers and relationship banking model for uk smes. as at 30 june 2016, the bank serves around 14 million active customers with c. 20, 000 employees and operates through 847 branches ( which includes 58 university branches ) and 69 regional corporate business centres. santander uk is subject to the full supervision of the financial conduct authority ( fca ) and prudential regulation authority ( pra )
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
house votes to condemn trump's'racist'comments latest stories, 1 dead, 8 hurt in colorado school shooting ; 2 in custody two students opened fire tuesday inside a charter school in an affluent suburban denver community not far from columbine high school, killing a teenager, wounding eight and spreading terror before they were taken into custody with no injuries, authorities said. douglas county sheriff tony spurlock said the pair walked into the stem school highlands ranch and began shooting students in two classrooms. within minutes, deputies at a nearby sheriff's department substation entered the school and arrested the two suspects after a struggle. " as officers were arriving at the school, they could still hear gunshots, " douglas county undersheriff holly nicholson - kluth said. authorities did not release the name of the student who died, but said it was an 18 - year - old man. " i have to believe that the quick response of the officers that got inside that school helped save lives, " spurlock said. he did not identify the suspects, but said they are an adult and a minor who were not previously known to authorities. authorities planned to search their homes and a vehicle at the school, he said. the shooting comes nearly three weeks after neighboring littleton marked the grim 20th anniversary of the columbine school massacre that killed 13 people. the two schools are separated by about 7 miles ( 11 kilometers ) in adjacent communities south of denver. it also comes exactly a week after a gunman killed two students and wounded four at the university of north carolina at charlotte. the stem school highlands ranch is a public charter school with more than 1, 850 students in kindergarten through 12th grades. witness accounts student christian paulson told television station kmgh that he was in study hall when he saw kids running and shouting, " school shooter! " " and i'm like, what? is this real or fake? and then i just went after them, " christian paulson said. " and apparently, this is all real. and i tried to run with my life, but i'm out of breath. " rocco dechalk, who lives near the school, told television station kusa that he saw so many students running past his house that at first he thought it was a gym class. he went outside and saw a teenage boy who had been shot in the back being helped by a teacher and another student. they brought the boy into his kitchen and alerted a police officer, who sent for an ambulance. " he made a comment, '
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
spin or whoppers? over the last decade, the media have become obsessed with'spin '. it's rare to pick up a newspaper without some reference to it. we have satirical programmes about it. but, i'm not sure there is any more of it today than when bernard ingham span for margaret thatcher, although it's probably more professionally done nowadays. we shouldn't be surprised by'spin ', for it is simply'putting the best gloss on your story '. surely nobody expects that anyone, whose reputation is in the public arena, would deliberately go out to'put the worst gloss'on what they want to say? but there is a big difference between'spin'and'telling whoppers '. i only wish our media became more obsessed with the latter than the former. in that way, they would do a public service by properly holding public representatives to account. my barnsley colleague, michael dugher, has just published a long list of'whoppers'that david cameron has told at prime ministers'questions over the last 12 months. of course, we all occasionally make mistakes. last week, my friend david blunkett got something wrong in an interview on radio 4 ; but, discovering his mistake, he was back on the radio within 30 minutes to apologise and to correct his error. but, to the best of my knowledge, david cameron hasn't once set about correcting one of his'whoppers '. he does us all a dis - service. and these things are not unimportant, because our prime ministers's statements are publicised throughout the world and, if left uncorrected, give a clearly wrong impression of what is happening. judge for yourself, with these examples of what mr cameron said at pmqs on january 25th and what the facts actually are : david cameron : " hospital waiting times are down " fact : the number of patients not being treated within 18 weeks has soared by 43 % since mr cameron became pm david cameron : " disabled children will not have their benefits cut. " fact : department for work and pensions'assessment on the new universal credit showing that the rate paid to disabled children will fall from ยฃ53. 84 to ยฃ26. 75 a week. david cameron : " there are more people in work today than there were at the time of the last election " fact : the office for national statistics says there are now 26, 000 fewer people in work than at the last election.
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
inquest into albanian seaman's death postponed as official investigation continues bethany whymark published : 4 : 37 pm february 8, 2019 alfred ismaili at home in albania with his three young children. picture courtesy of the ismaili family. - credit : archant an inquest into the death of an albanian seaman in west norfolk has been postponed again while investigations continue into the accident which led to the death. alfred ismaili, 36, died on february 1, 2018 while working on a cargo ship at alexandra dock in king's lynn. the maritime and coastguard agency is undertaking an investigation into his death, in which suspected breaches of regulation have been uncovered. johanna thompson, assistant coroner for norfolk, said that additional evidence needed to be submitted in the on - going investigation including on safe hatch lifting practises. mr ismaili's inquest opening heard he died from a blunt force trauma injury. a previous inquest review heard that the investigation into his death could lead to a criminal prosecution. a further pre - inquest review was scheduled for may 2, 2019.
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
invisible hands voices from the global economy edited by corrine goria foreword by kalpona akter the men and women in invisible hands reveal the human rights abuses occurring behind the scenes of the global economy. the men and women in invisible hands reveal the human rights abuses occurring behind the scenes of the global economy. these narrators โ€” including phone manufacturers in china, copper miners in zambia, garment workers in bangladesh, and farmers around the world โ€” reveal the secret history of the things we buy, including lives and communities devastated by low wages, environmental degradation, and political repression. sweeping in scope and rich in detail, these stories capture the interconnectivity of all people struggling to support themselves and their families. narrators include kalpona, a leading bangladeshi labor organizer who led her first strike at 15 ; han, who, as a teenager, began assembling circuit boards for an international electronics company based in seoul ; albert, a copper miner in zambia who, during a wage protest, was shot by representatives of the chinese - owned mining company that he worked for ; and sanjay, who grew up in the shadow of the bhopal chemical disaster, one of the worst industrial accidents in history. " a compelling message about the plight of labor workers worldwide... hope for change comes in various forms throughout goria's collection, including the strides made by bangladesh worker kalpona akter, who, after years working in a textile mill, became a staunch activist and labor rights advocate. their common trait, aside from a laborious livelihood, is a marked desire to initiate a movement to bar unreasonable and perilous working conditions and unfair wages. goria dramatically acknowledges the legion of overlooked workers who'produce the things we use every day,'expressed through the carefully chosen words of crusaders who share each other's individual hopes and hardships. powerful and revealing testimony to the injustices of manual labor, infused with inspiration for global change. " โ€” kirkus reviews " compiled and edited by lawyer goria, these oral accounts of labor abuses and the struggles of the working poor cover most corners of the globalized economy. stories from workers and labor activists in far - flung locations, including mexico, zambia, bangladesh, china, and south korea, convey a sobering uniformity of harsh working conditions, low wages, coerced labor, and ruthless retribution against unions and advocates for workers'rights. readers hear from bangladeshi garment workers who struggled to get monthly minimum wages raised from $ 15 in 1994 to $ 43 by 2010 ;
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
let's do better from now on, investing on your skin has soooo many benefits. that's right, you better start now! beauty in seconds is providing beauty products as well as beauty info for your guidance, please don't hesitate to send us your comment regarding new beauty products because your information will be very helpful to others.
{ "redpajama_set_name": "RedPajamaC4" }
q : limit on symbol table? i've been looking into some corner cases for loading python ( 2. 7 on osx ) files as configuration files. i wanted to see what the behavior was if i circularly ran execfile. i expected a out of memory error or a lot of swapping to occur, but i was rather surprised when i got a different result. i setup a test scenario as follows :'d'python script with : #! / usr / bin / python x = 0 execfile ( " d1 " )'d1'python script with : #! / usr / bin / python x + = 1 print " x = % d " % x execfile ( " d2 " )'d2'python script with : #! / usr / bin / python x + = 1 print " x = % d " % x execfile ( " d1 " ) the result : $. / d x = 1 x = 2 x = 3... removed for brevity... x = 997 x = 998 x = 999 traceback ( most recent call last ) : file ". / d ", line 5, in < module > execfile ( " d1 " ) file " d1 ", line 5, in < module > execfile ( " d2 " ) file " d2 ", line 5, in < module > execfile ( " d1 " )... removed for brevity... file " d1 ", line 5, in < module > execfile ( " d2 " ) file " d2 ", line 5, in < module > execfile ( " d1 " ) file " d1 ", line 5, in < module > execfile ( " d2 " ) keyerror :'unknown symbol table entry'i was just curious if there was someone who could explain what is happening here? why does it stop after executing execfile ~ 1000 times? a : from the python source code, objects / dictobject. c : / * note that, for historical reasons, pydict _ getitem ( ) suppresses all errors * that may occur ( originally dicts supported only string keys, and exceptions * weren't possible ). so, while the original intent was that a null return * meant the key wasn
{ "redpajama_set_name": "RedPajamaStackExchange" }
bully - boy pro lifers stake out prime minister's home - shameful tactics do nothing but fuel anger in abortion debate daniel o'carroll enda kenny : irish taoiseach target of aggressive abuse over abortion legislation. pro life campaigners aggrieved at proposed legislation which would legalize abortion under limited circumstances have been mounting a vitriolic campaign of abuse against taoiseach ( prime minister ) enda kenny in recent weeks. in doing so they have seriously undermined the cause they profess to serve and sustained images of a vigilante mob attempting to suppress dissenting views through crude intimidation. the latest in a series of disquieting incidents has seen masked men campaigning outside the castlebar home of the taoiseach while his wife and son were at home yesterday before being removed by police. earlier that day, kenny was repeatedly heckled as he tried to conduct an opening ceremony at a completely unrelated commemoration ceremony in county longford where he faced charges that he was proposing to " kill the unborn " in supporting the bill. last week he disclosed to the dail how he had received letter written in blood, sarcastic medals, plastic fetuses, and medical scapulars as result of the legislation, now in draft stage, which would allow abortions to be performed where the mother's life was in imminent danger as a result of the pregnancy. despite kenny's fervent catholicism, he has sustained his mantra that " my book is the constitution " and has refused to back down in the face of the often unsavory methodologies being employed by those opposed to the passage of the protection of life during pregnancy bill. other politicians have been similarly inundated with phone calls from both legitimate pro - life lobbyists and more dubious vigilante crooks. one politician described the concerted effort as a programme of " widespread intimidation ", saying that politicians had been spat at and people had been turning up at their homes at unusual hours in desperate attempts to convince them to vote against the proposals. one female td, allegedly, received a threat that her throat would be cut. should she vote with the government. each td ( member of parliament ) is estimated to be receiving 50 telephone calls a week from those opposed to the idea - - a relatively vast volume in a country with a comparatively small tradition of organized political lobbying. last december the communications regulator was forced to intervene after members of the public reported a spate of automated telephone calls beseeching them to lobby their tds to oppose the bill
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
enjoy these welcoming and amenity - rich communities you can call home. located on madison's south side, the burr oaks community provides an open and friendly atmosphere for individuals ages 62 and older with low income. beautiful apartments and grounds offer the perfect backdrop for a life overflowing with friends, community, and family. this alluring facility features non - smoking, one - and two - bedroom apartments with a balcony or patio and free wi - fi in all units. this retirement community in madison, wi fosters a social environment by hosting a variety of interactive events for residents. attend a game night for some friendly competition or socialize over morning coffee on the community patio. you can also stay active at the fitness center or pamper yourself at the on - site hair salon. whatever activities you choose, this amenity - rich community offers everything you need to live an active and relaxed lifestyle. interested in burr oaks senior apartments in madison, wi where you'll enjoy a quiet, refuge - like atmosphere and proximity to shopping, dining, parks, and more? learn more here. one of the standout retirement communities in madison, wi, greentree glen is located in a peaceful, wooded neighborhood on the west side. its cozy architecture, meticulously maintained grounds, and modern common spaces make it a favorite among residents. this smoke - free facility offers a warm and friendly atmosphere for seniors ages 62 and older. greentree glen apartment homes boast newly - renovated one - and two - bedroom units with furnished appliances, walk - in closets, and free wi - fi. the welcoming community at greentree glen also organizes countless activities and social gatherings for residents. just off the main road, this carefree retirement community is situated near one of madison's largest shopping hubs, keeping you close to the action. you can also enjoy your favorite pastimes on the community patio, fitness center, or on - site library. there's no doubt this charming community will have you enjoying a relaxed and active life in no time. for more information about the quiet, homey, and relaxing escape you'll find at greentree glen senior apartments, click here. this beautiful retirement community for individuals ages 55 and older is located on madison's residential east side. westminster is a newer apartment community for seniors featuring gorgeous modern brick construction and beautiful open green spaces. it offers a variety of one - and two - bedroom floor plans with private balconies, patios, and furnished appliances. this pet - friendly facility also features abundant amenities
{ "redpajama_set_name": "RedPajamaC4" }
this week's portion, shimini, carries us deeper into the book of leviticus. the first half of the portion is the initiation of the sacrificial cult : the torah describes in dramatic fashion the first sacrifices aaron and his sons carry out in their role as priests. they slaughter various animals corresponding to the different types of offerings, they splatter blood on the altar and fire consumes the corpses. aaron and his sons then bless the people and the people fall on their faces. the second half of the portion is an explication of the dietary laws. we are told specifically which animals are kosher and which are not : we learn that kosher land animals have cloven hooves and are ruminants, kosher birds are not birds of prey and kosher sea creatures have fins and scales. we also learn some other regulations as to what may or may not be eaten. there are many questions raised by this short passage, but we can understand from the text that nadav and avihu did something wrong, and they were punished for their transgression. put in context with the passage that came before, we can have an understanding of what perhaps their transgression was. the torah says they offered " alien fire, which god had not enjoined upon them. " earlier in the parasha, when describing the initial sacrifices, the torah says, at various times, " this is what god has commanded, " and " according to regulation " and " as moses had commanded. " what the torah is telling us is that while the first set of sacrifices was what was commanded, what nadav and avihu offered was not. essentially what they were doing was offering a sacrifice that was outside the norm of the ordained and organized system of sacrifices. it seems very extreme, though. did they really deserve death for a slight deviation from the norm? and besides, is what they did so wrong? it can be argued that what nadav and avihu did when they offered the additional sacrifice was to further glorify god โ€” they were not offering something in contradistinction to, but rather in addition to, what was proscribed, due to their zeal, or desire to serve, or love of torah. this may be, but what perhaps the torah is trying to teach us in this story is the perils of individualism. the extreme nature of the story aside โ€” and this isn't the first time a story in the torah is extreme it its details โ€” the torah is
{ "redpajama_set_name": "RedPajamaC4" }
cookies are small files placed on your device or held in your browser memory, when you visit our website. the cookies that we use do not store any personal or confidential information about you. disabling these cookies may prevent you from using certain parts of this website.
{ "redpajama_set_name": "RedPajamaC4" }
search engine optimisation โ€“ wix permits you to edit page meta tags, web page names, and much of your primary search engine marketing musts. i will go to a trucking web site for instance and get half the advertisements for internet design. domain identify is the web site url, the link or handle that needs to be entered within the deal with bar of your browser to open an internet site. the templates are prime quality, but nobody desires to have an internet site which appears to be like like another. website creator is definitely a licensed model of netobjects'fusion 12 ( originally launched in 2010 ) and is lumbered with an old school interface and unhelpful jargon ( asking, for instance, does your host help cgi / perl? ). some of the most popular android, computer and iphone video games have been developed using the present lot of software program packages. if you want, you will get the free trial and make a demo website to get an understanding about creating your website. i use webs ( previously freewebs ) however i did not realise how many free web builders there were out there. on condition that google units a lot retailer by website velocity nowadays, that is an issue. webnode can be used with any domain ( e. g. as ). it implements plenty of web site parts ( polls, articles, forums, lists, faq varieties, etc. ). customers can use it with any well - liked browser.
{ "redpajama_set_name": "RedPajamaC4" }
this beautiful diy citrus mint hand soap is made with essential oils and makes a great gift! so who says that soap needs to be purely utilitarian? i don't know about you, but when it comes to my hand soap, i am drawn to two key things ; scent and packaging, hands down. i have always been a packaging junkie and just a sucker for beautiful design. i love to go to stores and just look at all of the different ways companies have branded their products. i pay special attention to the colors, patterns and textures of the paper used. i think it's the marketer in me or maybe i'm just a geek โ€ฆ there's that. one other important area that we just can't avoid is the topic of chemicals. yes, those nasty chemicals that have found their way into all of our health and beauty products. do you remember the antibacterial craze? omg! it was like the companies and the media were telling us to live in a sterile bubble. it was so bad that people were ready to go add a hazmat suit to their daily wardrobe. there were antibacterial soaps, wipes, you name it. we became this germophobe society where " pass the purell " became a thing at every social event. so why is all this so bad? well you see, we need our immune systems to keep us healthy, and by over using all of these antibacterial products, we start to kill those natural fighters in our bodies. last year the fda finally announced that there was not enough scientific evidence to show that over - the - counter antibacterial soaps were better at preventing illness than washing with plain soap and water. if you want to find out more about the nasty chemicals, just google triclosan, but make sure you are sitting down when you read about what types of chemicals have been allowed in our products. it is not pretty! well enough of being a debbie downer. let's get on with the good stuff. this hand soap could not be easier to make with just a hand full of ingredients, that won't compromise your immune system. we will be scenting our soap with essential oils which not only smell amazing, but have some great health benefits. i spoke about essential oils in my essential oils 101 post. this is a awesome place to start, especially if you are new to essential oils. for this blend, i chose peppermint,
{ "redpajama_set_name": "RedPajamaC4" }
note : javascript is disabled or is not supported by your browser. for this reason, some items on this page will be unavailable. for more information about this message, please visit this page : about cdc. gov lab safety report on ebola virus transfer centers for disease control and prevention ( u. s. ). office of the director. the centers for disease control and prevention is reporting today that a small amount of material from an ebola virus experiment that was securely transported from a select โ€ agent โ€ approved bsl โ€ 4 lab to a select โ€ agent โ€ approved bsl โ€ 2 lab may have contained live virus. the material was on a sealed plate but should not have been moved into the bsl โ€ 2 laboratory. we cannot rule out possible exposure of the one laboratory technician who worked with the material in the bsl โ€ 2 laboratory. there was no possible exposure outside the secure laboratory at cdc and no exposure or risk to the public. the event was discovered by the laboratory scientists yesterday, december 23, and reported to leadership within an hour of the discovery. the event is under internal investigation by cdc, was reported to secretary of health and human services sylvia burwell, and reporting to the internal and national select agent programs has been initiated. cdc will provide a report on the event when the investigation concludes. the bsl โ€ 2 laboratory area had already been decontaminated and the material destroyed as a routine procedure before the error was identified. the laboratory was decontaminated for a second time, and is now closed and transfers from the bsl โ€ 4 lab have been stopped while the review is taking place. " i am troubled by this incident in our ebola research laboratory in atlanta, " said cdc director tom frieden, m. d., m. p. h. " we are monitoring the health of one technician who could possibly have been exposed and i have directed that there be a full review of every aspect of the incident and that cdc take all necessary measures. thousands of laboratory scientists in more than 150 labs throughout cdc have taken extraordinary steps in recent months to improve safety. no risk to staff is acceptable, and our efforts to improve lab safety are essential โ€ โ€ the safety of our employees is our highest priority. " cdc will continue to provide support during the ebola epidemic through its research and diagnostic lab work. skilled lab scientists in the ebola response are valued contributors to ending this epidemic. based on what was learned during the lab science and safety reviews earlier this year, cdc has taken several immediate actions in this incident
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
rude, carnal, barbarous, ferocious, coarse, brutish, ruthless, brutal, savage, gross, inhuman, rough, bestial. oppressive, painful, odious, gnawing, insufferable, torturing., hurtful, bitter, stabbing, inflaming, woeful, disagreeable, distressful, annoying, wrenching, bothersome, trying, smarting, piercing, irksome, besetting, stinging, aggravating, harrowing, grievous, offensive, agonizing, sore, horrendous, arduous, throbbing, grueling, unbearable, cutting, biting, aching, unpleasant, tormenting, withering, acute, miserable, cramping, burdensome, irritating, anguishing, excruciating, crushing, chafing, severe, troublesome, uncomfortable. ruthless, bloodthirsty, uncompassionate, unmerciful, hellish, inhumane, merciless, demoniac, fiendish, unforgiving, hardhearted, dog - eat - dog, unfeeling, pitiless, cutthroat, brutal, barbaric, unsympathetic, stony, unpitying. bloodthirsty, ruthless, unfeeling, sinful, excruciating, tyrannical, inhuman, callous, vengeful, sadistic, merciless, hateful, inexorable, rancorous, bestial, inhumane, painful, heartless, ferocious, depraved, wicked, unkind, malevolent, bitter, unnatural, degenerate, spiteful, revengeful, hellish, brutish, barbarous, vicious, relentless, virulent, demoniac, harsh, hard, brutal, pernicious, monstrous. roughshod, hard, brutal, savage, inhumane, harsh, fell, heartless, vicious, unkind, rigorous, barbarous. unjustified, unreasonable, unfair, partial, arbitrary, one - sided, unjust, biased, wrongful, unequal.
{ "redpajama_set_name": "RedPajamaC4" }
in buildings containing flats or in housing developments where there are private areas used in common and not owned by specific properties, the cost of maintaining those areas needs to be recovered. with flats these charges are called'service charges'and in housing developments they are called'rent charges '. the maintenance is usually organised by a third party, such as a landlord or a management company. usually an estimate as to the charge is given at the beginning of a pre - defined year and a payment on account made. at the end of the year, accounts are produced and balancing credits or additional payments made. the service charge costs can be significant and you need to consider this when purchasing. you need to consider the history of payments and future payments. buildings with flat roofs or lifts can produce particularly high service charges. you can access any of our property lawyers at any of our offices spread throughout surrey, hampshire and greater london including kingston upon thames, bordon, cheam, canary wharf, leatherhead, raynes park, surbiton, tolworth or walton on thames.
{ "redpajama_set_name": "RedPajamaC4" }
on 2012 - 10 - 02, the consumer product safety commission ( cpsc ) published a recall regarding trx suspension trainer devices due to a potential fall hazard. this product sold new beginning in january 2006 for about $ 150 to $ 200. about 40, 000 units are involved in this fitness anywhere suspension trainer device recall. instance ( s ) of injuries have been reported. learn more and find out what to do if you own this product below. this was the 2nd recall of products in the exercise machines / equipment category in 2012. since 2005, there have been approximately 60 similar recalls, involving about 6 million product units. the strap length - adjustment buckles can break, posing a fall hazard. these items were sold new + at health and fitness stores and studios nationwide and online at www. fitnessanywhere. com from january 2006 through december 2009 for about $ 150 to $ 200. fitness anywhere has received 570 reports of the strap length - adjustment buckles breaking with 82 reports of the user falling, including 13 reports of head, face, shoulder and hip injuries. own a different suspension trainer device?
{ "redpajama_set_name": "RedPajamaC4" }
by now, fans may have heard slaughterhouse's stadium anthem track and next single, " my life, " featuring cee lo green on the hook. well, xxl recently asked the four - man contingent, consisting of crooked i, joell ortiz, joe budden and royce da 5'9 " how the cee lo assist came out for the second single off their shady records debut lp, welcome to : our house, due june 12. " yeah man, cee lo owed me a favor from way back, " joe budden joked and laughed. goodie mob probably feels the same. cee lo, a permanent vocal coach on the nbc reality show, the voice, reunited with goodie mob, his longtime crew, for a performance on the mainstream american show last month. that performance came months after he shared the worldwide super bowl xlvi halftime stage with madonna in february. of course, cee lo isn't the only big assist that slaughterhouse is getting on welcome to : our house. eminem has taken a very hands - on approach for this project, the group's second overall album, but shady records debut.
{ "redpajama_set_name": "RedPajamaC4" }
will the truck / van gas transfer system void my vehicle factory warranty? no, it will not void your vehicle warranty. is the truck / van gas transfer system a permanent installation? yes the system is meant to be permanently installed, however it can easily be removed and installed onto another vehicle if needed. what kind of flow can i expect from the truck / van gas transfer system? since the system relies on the vehicles fuel pump the flow will be directly determined by the factory fuel pump that is on your vehicle. the majority of vehicles we have tested will flow over 1 gallon per minute. what should i do if the truck / van gas transfer system causes my vehicle to stall when i use it? although this situation is very rare, you can prevent your vehicle from stalling by adjusting the flow valve on the back of the unit. instead of turning this valve all the way open you can try opening it only ยฝ to ยพ of the way. is the truck / van gas transfer system pt500 approved for use in california and other epa regulated states? yes this system has been approved for sale in california and all epa regulated states. can the truck / van gas transfer system be used with diesel? no this system is designed to only work on gasoline applications. how do i know if the pt500 truck / van gas transfer system will work with my vehicle? the system was designed to work on any fuel injected truck or van that has factory installed quick disconnect fuel lines. most trucks from the late 1990's and newer have these connections. if you are not sure you can take a look at your vehicle fuel line to see if it is equipped with quick disconnects. will the mc100 motorcycle sharing system work on my motorcycle? the system uses the factory quick disconnect fuel lines on 2001 and newer fuel - injected harley davidson bikes ; therefore it will only connect to those motorcycles. however you can still pump fuel into any brand motorcycle as long as the host bike is a fuel injected harley. is the mc100 motorcycle sharing system a permanent installation? no, the systems uses quick disconnects which allows it to be installed and removed in just seconds. after use just simply pack the system away in the provided storage pouch. what should i do if there is fuel leaking from where i connected the mc100 system to my motorcycle? first turn off the motorcycle and remove the mc100 system. take a look up inside the motorcycles factory quick disconnect check valve and inspect the lower o - ring. the majority of the time this o
{ "redpajama_set_name": "RedPajamaC4" }
mumbai : it's a sultry, smoggy afternoon, and shivaji sakaram sawant is looking a little flustered. a slight 57 - year - old from the nearby village of colaba, sawant is in his 30th year as a dabbawala ( " one who carries the box " ), part of an army of white - clad men who deliver about 200, 000 homecooked lunches to mumbai's workers each day. since the 1890s, dabbawalas have navigated this city's crowded, chaotic streets, riding heavy bicycles with lunch tins โ€” picked up from various workers'homes โ€” dangling from the handlebars. endurance is vital, as is an encyclopedic knowledge of the city : mumbai's dabbawalas are said to make one error per 6 million deliveries, and any deviation from this rate is not taken lightly. the traffic, as ever, is terrible, but the car eventually glides to a stop at the set of a bollywood musical. followed by a videographer, sawant hands food to the young dancers, punctuating his delivery with the same courteous bow he always offers his customers. and that's that. the camera is switched off. the tins are handed back. sawant leaves the set quietly, on foot, heading off to catch the crowded train that will take him home.
{ "redpajama_set_name": "RedPajamaC4" }
let it be known that the wearer of this shirt is so much more kowai ( scary ) than kawaii ( cute ). these two - color baseball shirts are made of a super - soft cotton baby rib in stylish colors, with 3 / 4 length sleeve. it's certain to be your new favorite shirt!
{ "redpajama_set_name": "RedPajamaC4" }
why hire a trial attorney? ohio supreme court : warrantless search of student backpack was ok on behalf of the law offices of saia & piatt, inc. | may 18, 2017 | criminal defense if a high school student leaves his backpack on the bus, would it be fair for him or her to expect it to be left unopened? would it put anyone in danger? what if there was a rumor the student was a gang member? these are the questions the ohio supreme court recently answered in the case of a columbus high school student who was charged with possession of a deadly weapon after leaving his bag unattended on a bus. a little background : the u. s. supreme court had already found in the 1991 case of florida v. bostick that bag searches on buses are constitutionally doubtful in the best of circumstances. however, that differs somewhat from the one heard by the ohio supreme court. moreover, students have less privacy rights than adults. couldn't any unattended bag contain a bomb? according to the courthouse news service, on one february morning in 2013, a student left his backpack on a bus. a school security guard found it and opened it only enough to identify its probable owner. based on a rumor that the student was a gang member, however, he brought the backpack to the school principal instead of returning it to the student. the school principal felt free to empty the bag, and inside they found bullets. the pair then contacted a police officer. the principal, the security guard and the police officer confronted the student in a hallway, where the police officer executed a take - down and incapacitated the student. they then searched another bag the student had on his person. inside there was a gun. the student was charged with possession of a deadly weapon, and argued that these searches were unreasonable โ€” and therefore illegal under the fourth amendment to the u. s. constitution. he asked for the evidence to be suppressed, and both the trial court and the franklin county appeals court agreed. the ohio supreme court disagreed and sent his case back to trial. first, the court reaffirmed that schools are " special needs " settings that allow more warrantless searches than would be allowed for adults. next, they reasoned that at each step, the child's right to privacy was outweighed by the " in compelling governmental interest in protecting public - school students from physical harm. " after all, they reasoned, any unattended bag could contain a tiny explosive device fashioned out of carbon dioxide cartridges called
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
our chairman to step down sir hector sants to step down as our chairman to chair the new single financial guidance body we congratulate sir hector sants on his appointment as the first chair of the new single financial guidance body, and announce with regret that he will be stepping down from his role as chair of the charity on 2 october to take up the role on 3 october 2018. phil andrew, stepchange ceo, said : " we are sad to be losing sir hector as he is an outstanding chairman, but we are delighted that he's moving to chair a new body which is critical to the long term future of the sector and the wider economy. " we are enormously grateful for the role that sir hector has played in chairing our board of trustees, to which he has brought an excellent mix of extensive experience, insight and dedication, and we wish him every success in his new role. " sir hector sants said : " it has been a privilege to be the stepchange debt charity chairman since april 2015. it has touched me deeply to witness at first hand the sheer scale of the need for debt advice, a need that is not always fully appreciated but that i will seek to continue to address in my new role. " the recruitment process to find a new chair for the charity is already underway. existing stepchange board member and senior independent director, chris stern will act as an interim chairman if the recruitment process requires more time. get in touch with our media team for more information about our work. 0207 391 4598 ( office hours only ) press @ stepchange. org connect with us through social media and get all the latest news about our campaigns. charity updates on linkedin
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
would the bbc work better as a company, charity, instead of a new royal charter? the bbc exists because, every ten years, the monarch has granted another charter. given the changes in the media landscape in the last decades, should the bbc move to another status? bbc, plc 2017 in a set of articles earlier in the year, i investigated the bbc as a public company, sometimes run by subscription and other times by adverts and by subscription. british broadcasting charity one option that must be on the table is the change in the bbc from having a royal charter to being a charity. the claims for the bbc's royal charter seem to be rather bust these days. aside from the democratic implications in the 21st century of the head of state being able to make law by proclamation, the claimed benefits are long since gone. the last three prime ministers have done away with once - treasured the bbc news independence. tony blair used the strategy of a judge - lead whitewash ( using the logic " the prime minister cannot lie because he is the prime minister " ) to weaken the independent broadcaster. gordon brown, by providing " free " tv licences to pensioners allowed the state to co - opt a sizable part of the funds supposedly hypothecated from the tv fee. he could have provided pensioners with a ยฃ150 uplift in their pensions. this pensioner allocation was used by prime minister david cameron to strong arm dg thompson into cutting back the bbc in an egregious funding settlement. it is clear that the bbc is no longer independent of government, the royal charter special guarantee no longer respected by ministers " of the crown ". so, perhaps it would be sensible to do away with the 10 - year cycle of renegotiation and move the broadcaster to the status of the british broadcasting charity, and hope that the charity commission can provide a better protection for our national broadcaster than elderly monarch does. bbc salami - slicing returns to overnight services? 1 # greatbbc campaign launched 2 goodbye bbc red button! 3 want to know how much the bbc spend in england, scotland, wales and ni per home? 4 s4c and welsh exceptionalism? 5 bbc future : make sure you make the deadline 6 sandra blickem i am constantly disappointed with the bbc the news is sparse in content and appears very biased the scheduling is terrible putting one programme type on two or three channels at the same time, ie sport instead of putting sport specials on the " secondary " channels 3 or 4 they remove other popular
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
the riley theatre at northern school of contemporary dance. unfortunately comprehensive archives prior to 2001 may have been lost to fire. we are looking to make these histories as complete as possible and if you have details of productions and dates which came to leeds the riley theatre - nscd we'd love to hear from you.
{ "redpajama_set_name": "RedPajamaC4" }
community oversight board chair : fixing police body cam issue'as important as living and breathing'nashville's community oversight board wants body and dash cameras on the streets as soon as possible, even amidst the budget crisis facing city leaders. community oversight board chair : fixing police body cam issue'as important as living and breathing'nashville's community oversight board wants body and dash cameras on the streets as soon as possible, even amidst the budget crisis facing city leaders. check out this story on tennessean. com : https : / / www. tennessean. com / story / news / local / 2019 / 12 / 10 / nashville - community - oversight - board - police - body - cameras / 2633823001 / mariah timms, nashville tennessean published 5 : 00 a. m. ct dec. 10, 2019 | updated 3 : 56 p. m. ct dec. 10, 2019 even under the strain of a budget crisis, the community oversight board plans to continue its push for body cameras on all nashville police officers as soon as possible. " it's not enough anymore to say you don't have the money. this is important as living and breathing in this city, " cob chair ashlee davis said monday. " that's how important this is. that's not ok. " the board plans to issue a formal policy recommendation soon explaining their focus on transparency, as well as urging other departments to research possibly less expensive ways to store data and effectively use labor in processing video. the board's executive team met monday afternoon to assess a draft version of the recommendation they plan to issue to other stakeholders. the board, which was established via a 2018 referendum approved by nashville voters, is tasked with investigating allegations of police misconduct. the board also can recommend policy changes for the department. body, dash cameras on hold a day after the board meeting, mayor john cooper announced plans to roll out a limited number of body cameras in 2020 while policy and cost questions are answered. the city pulled back from a department - wide roll out last month amid a budget crisis and concerns over a mounting price tag. cooper's policy director john buntin said it could cost more than $ 40 million per year to operate the cameras and analyze their footage, which he said was " deeply concerning " in the midst of a budget shortfall. the delay has been tied to the state comptroller's urgent report to city leaders in november that nashville was running out of money to pay its bills. the com
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
q : print dictionary keys and values in one column in tcl i am new learner of tcl scripting language. i am using tcl version 8. 5. i read text file through tcl script and count similar words frequency. i used for loop and dictionary to count similar words and their frequency but output of the program print like this : alpha 4 beta 2 gamma 1 delta 1 but i want to print it in one column each key, value pair of dictionary or we could say each key, value pair print line by line in output. following is my script in tcl and its output at the end. set f [ open input. txt ] set text [ read $ f ] foreach word [ split $ text ] { dict incr words $ word } puts $ words output of the above script : alpha 4 beta 2 gamma 1 delta 1 a : you would do : dict for { key value } $ words { puts " $ key $ value " } when reading the dict documentation, take care about which subcommands require a dictionaryvariable ( like dict incr ) and which require a dictionaryvalue ( like dict for ) for nice formatting, as suggested by donal, here's a very terse method : set maxwid [ tcl : : mathfunc : : max { * } [ lmap w [ dict keys $ words ] { string length $ w } ] ] dict for { word count } $ words { puts [ format " % - * s = % s " $ maxwid $ word $ count ] } or, look at the source code for the parray command for further inspiration : parray tcl _ platform ; # to load the proc info body parray
{ "redpajama_set_name": "RedPajamaStackExchange" }
q : reactivecocoa - observing isfirstresponder property and uitextfield with clearsonbeginediting set to yes i am new to reactivecocoa, but i think it's very nice and outstanding technique for reducing code complexity. i just started experiencing with the framework, and not everything is clear for me at the moment, so excuse me if my problem can be solved in some obvious way. in my app i have login view controller with simple form contains two text fields ( username and password ) and a button. i would like the button to be disabled if any of two text fields is empty. so, i wrote this code : rac ( self. loginbutton, enabled ) = [ racsignal combinelatest : @ [ self. usertextfield. rac _ textsignal, self. passwordtextfield. rac _ textsignal ] reduce : ^ ( nsstring * username, nsstring * password ) { bool valid = ( username. length > 0 & & password. length > 0 ) ; return @ ( valid ) ; } ] ; it's very simple and it's working. the problem is that one of my text fields ( the password field ) has securetextentry and clearsonbeginediting properties set to yes. i will try to explain unwanted behavior that i am experiencing with this configuration : let's assume that both username and password fields are not empty. in this case the button is enabled. when user taps on password field, it becomes first responder ( keyboard appears and user can enter his password ), but because of clearsonbeginediting being set to yes for that field, the previously entered password is cleared from the text field. that's way password field is now empty. the problem is that signal is not being sent, so the button remains enabled, despite the password field is empty. my first idea to solve this issue ( well, more like workaround solution ) was to observe isfirstresponder property on password field beside observing text changes. that's way the block that checks if button should be enabled would be called when password field becomes first responder. i don't know if this solution works, because i have no idea how to implement it using reactivecocoa. i have looking for creating a signal for isfirstresponder property changes, but without a luck. it might be not the best approach
{ "redpajama_set_name": "RedPajamaStackExchange" }
package com. basho. riak. client. itest ; import static org. junit. assert. * ; import org. apache. commons. httpclient. uriexception ; import com. basho. riak. client. request. requestmeta ; import com. basho. riak. client. response. httpresponse ; public class utils { public static requestmeta write _ 3 _ replicas ( ) { return requestmeta. writeparams ( 3, 3 ) ; } public static void assertsuccess ( httpresponse response ) { if (! response. issuccess ( ) ) { stringbuilder msg = new stringbuilder ( " failed " ) ; msg. append ( response. gethttpmethod ( ). getname ( ) ). append ( " " ) ; try { msg. append ( response. gethttpmethod ( ). geturi ( ). tostring ( ) ) ; } catch ( uriexception e ) { msg. append ( response. gethttpmethod ( ). getpath ( ) ) ; } msg. append ( " - - " ). append ( response. gethttpmethod ( ). getstatusline ( ) ). append ( " ; " ). append ( " response headers : " ). append ( response. gethttpheaders ( ). tostring ( ) ). append ( " ; " ). append ( " response body : " ). append ( response. getbody ( ) ) ; fail ( msg. tostring ( ) ) ; } } }
{ "redpajama_set_name": "RedPajamaGithub" }
riverside youth theatre ( ryt ) was started in 1982 to provide opportunities for young people aged between 12 and 18 who have an interest in drama. members can join the acting team or the technical, and many members choose to experience both. productions range from period costume drama to musicals and are always demanding. we aim to encourage an interest and develop skills and experience in all aspects of theatre. actors experience auditions, rehearsals and the staging of real productions which are presented to live audiences. the technical team learn about lighting, sound and set building, and are involved in the rehearsals and live performances.
{ "redpajama_set_name": "RedPajamaC4" }
massachusetts gov. charlie baker says he's satisfied with the rollout of the state's first recreational marijuana retail stores. " i think it's gone what i would describe, i guess, as mostly according to plan, which is a good thing, " baker told masslive. two stores, cultivate in leicester and new england treatment access ( neta ) in northampton, opened on nov. 20, the first retail pot shops east of the mississippi. the cannabis control commission released figures tuesday showing consumers spent $ 2. 2 million at the two shops over their first five days operation, as leicester residents complained of traffic problems. the worcester county town's police chief, james hurley, told residents at a monday night emergency meeting that novelty of the new pot shop will eventually fade away. the five - member commission and the new agency's staffers are processing applications for additional retail shops across the state. " i think obviously for the commission this is the beginning and i'm anticipating that they'll learn as they go and if they need to make adjustments, they will, " baker said after an unrelated holiday event at faneuil hall. " but as i've said before, i thought the fact that they were deliberate in their approach to the rollout was the right way to pursue it. " recreational marijuana sales begin last week at two stores in massachusetts, the first to open on the east coast. baker, who opposed marijuana legalization when the issue was on the 2016 ballot, said drugged driving remains his " biggest concern. " " it's very important that people recognize and appreciate the fact that this is not something they should be doing if they're planning to be driving, " baker said, pointing to ride - hailing services like uber and lyft, as well as public transportation. " i just hope people take that part seriously, " he said. in a public awareness campaign on impaired driving, massachusetts public safety officials sought to equate operating a motor vehicle under the influence of marijuana with doing so under the influence of alcohol.
{ "redpajama_set_name": "RedPajamaC4" }
home bar top ideas. hello dear visitor. in the present new period, all information regarding the growth and development of technologies is extremely easy to get. you could find a variety of reports, suggestions, articles, all over the world in only seconds. along with specifics about your dream home can be accessed from numerous free places online. just like right now, you are looking for more knowledge about home bar top ideas, arent you? simply sit in front of your beloved computer or laptop which is connected to the net, you may get various useful unique suggestions and you may apply it for your purposes. do you know the concept of home bar top ideas that we present to you in this posting relates to the demand record about home bar top ideas. we learned that lots of people search home bar top ideas on search engines like bing. we tend to present a most recent image for you. although in our viewpoint, which weve presented the right home bar top ideas photo, however your thought might be little bit diverse with us. okay, you can use it as your guide material only. and home bar top ideas has been submitted by admin in category field. stellar bar top in a home with epoxy on top colorcopper copper. bar top epoxy resin liquid glass coating best bar epoxy. wooden bar top mesmerizing bar tops ideas epoxy resin bar top ideas. awesome home bar along with in bar top ideas 62474. bar top ideas home bar rustic with cove lighting in wine refrigerators. rustic home bar ideas rustic home bar best rustic man cave bar man. wall bar ideas black simple wall bar ideas xpoffice info. home bar top mini bar design. 9 fun home bar top ideas houspire. bar tops ideas home bar top ideas photo 4 of 5 bar top ideas epoxy. home bar tops appealing ideas for bar tops with additional home. home bar design ideas best of bar top designs home furniture. home home bar best images on ideas barn houses and homes decor. graceful home mini bar design also home mini bar designwith stoned. home bar tops ficherotecnia club. rustic home bar ideas wood stump epoxy rustic home bar top ideas. baby nursery surprising natural wood countertops littlebranch farm. ideas for home bar tops cumberlanddems us. ideas for bar tops copper top river side sheet metal home design. fetching interior design in home bar ideas with dark brown exquisite. outdoor bar top ideas medium size of smart outdoor bar ideas outdoor. home
{ "redpajama_set_name": "RedPajamaC4" }
q : execute shell script on cygwin from python i want to execute a shell script, on cygwin from python. the shell script is creating a file as an output. i tried import os import subprocess os. chdir ( r " c : \ \ cygwin64 \ \ bin \ \ " ) cmd = [ " bash ", " - c ",'cd / < path for the script > ;. / test. sh'] subprocess. call ( cmd ) a : this works : import os, subprocess os. chdir ( r " c : \ cygwin64 \ bin " ) cmd = [ " bash ", " - c ", " cd $ home ; pwd ; exit " ] ret = subprocess. call ( cmd )
{ "redpajama_set_name": "RedPajamaStackExchange" }
these demos are of songs that we put together originally planned to follow up the fateful dark with, some of the ideas ended up getting used, but none of them used as they were recorded here. we made these demos at satellite studios in enfield, north london. ( the same room where the channel 4 thing happened ). i think it's obvious we were listening to waaayyyy too much iron maiden.
{ "redpajama_set_name": "RedPajamaC4" }
ben lerman ben is the former nols wilderness medicine marketing coordinator and a wilderness first responder graduate. he enjoys rock climbing, backpacking, kayaking, and hopes to someday adventure in the mountains on each of the 7 continents. why you should take a wilderness first aid course by ben lerman on 3 / 21 / 19 8 : 12 am nols wilderness medicine student practices caring for a patient in the outdoors. photo by jared steinman. you love the outdoors. the beauty. the adventure. the chance to unplug. the quality time with family and friends, or even by yourself. whether you choose to explore the wilds by hiking, on the water, with a fishing rod in hand, or up a mountain road with your camper, the remoteness and rawness of it all is likely part of the appeal. topics : wilderness medicine, wilderness first aid, wilderness medicine 9 wilderness medicine acronyms you need to know by ben lerman on 3 / 11 / 19 12 : 44 pm nols students practice skills during a scenario on their course. photo by kyle wilson. you've taken your wfa, wfr, or wemt and learned about pas, abcde, and moi. so many abbreviations, so little time! whether you're filling out a soap note for a real - life patient or reviewing your skills with a nols case study, wilderness medicine's plethora of abbreviations and acronyms can be a lot to remember. topics : patient assessment, first aid, wilderness medicine quiz : sprains, strains, and athletic injuries topics : first aid, wilderness medicine, wilderness first aid, quiz gender - inclusive communication for first responders practicing a patient assessment during a course. photo by luis camargo. as a medical provider in the wilderness, it's important to not make judgments or assumptions. for example, rather than assuming a patient is low risk for a spine injury, you can use a focused spine assessment to gather information relevant to your decision. topics : first aid, wilderness medicine, inclusion, communication quiz : managing altitude illness by ben lerman on 8 / 8 / 18 8 : 44 am topics : first aid, wilderness medicine, wilderness first aid, altitude illness, quiz 7 fishing first aid hazards ( and what to do ) photo from nols alaska you're enjoying a beautiful day at your local fishing spot. fish are rising everywhere and you've hooked three big brook trout already. but your day can easily take a turn if you accidentally walk through
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
by christopher musico, contributor, crm magazine for the rest of the march 2009 issue of crm magazine, please click here. the notion of crm may not have been specifically top - of - mind among the founding fathers as they congregated during the unbearably hot summer of 1776 to hammer out the declaration of independence. even so, relationships between citizens and their representatives were precisely what those early patriots were helping to define, and the traditionally poor service the government has delivered in the two centuries since would have had many of them scratching their wigs. according to the latest scores from the american customer satisfaction index ( acsi ), the federal government still lags behind the private sector when it comes to keeping people happy. this year, the feds scored a 68. 9 out of a possible 100 points, while their commercial counterparts weighed in with a 75. the 68. 9 score represented a 1. 6 percent increase from last year, but the gap still remains. that turns out to be unsurprising, given rising consumer demands. " look at most enterprises today and you can [ almost always ] get 24 / 7 service, " explains ben madgett, an analyst for new york โ€“ based research firm datamonitor. " there's an expectation there now that you should get the same from government. " the increasing expectations are also seen by lisa sherwin - wulf, public - sector industry solutions manager for rightnow technologies, a provider of on - demand customer experience solutions. working with rightnow's 155 government - agency customers, there is growing pressure to increase operational efficiencies while at the same time ensuring that citizens can access any necessary information in their preferred channels. " people are expecting things like timely response by chat, interactive voice response, email, and web forums โ€ฆ something in addition to just walking into an office or calling on the telephone, " she explains. " the bar has definitely been raised. " government agencies on all levels, though, may have quite a bit of catching up to do. ken landoline, vice president of research for reno, nev. โ€“ based analyst firm synergy research group, declares the public sector " 15 to 20 years behind the customer care contact center world. " there is no doubt that many agencies are trying to improve their service offerings, but with a looming economic recession, less money to invest, and an ever - increasing population, will governments be able to catch up or just continue to run in place in the effort to provide citizen
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
lenin was sent into russia by the germans in the same way that you might send a phial containing a culture of typhoid or cholera to be poured into the water supply of a great city, and it worked with amazing accuracy. i got the ticket for nothing. hasn't this been the problem all along? linley will take you home. i have left my car keys behind. did you study hard in high school? my basket is under the table. this blanket will help keep seenu warm. this is a doghouse that i made myself. i'm hardly in a position to disagree. marty introduced kristin to his family. no one can see the kingdom of god unless he is born again. what can we possibly give them? christmas is just a week away. i understand why you're concerned. did you take a look at it? we will have a meeting at his house this evening. why are you in such a bad mood this evening? we came to the conclusion that we should help him. i paid her bill today. we're doing this to help glynn. i talked to laurent about what happened. you can take advantage of your free time. put on warm clothes, the night air is very cold. the computer has made a great impact on modern life. everybody likes me, except isabelle. marci thought that was a bad idea. she is thinking of suing as a last resort. he can run the fastest in his class. i think polly is suggesting that we should leave. we have to go by the rules. sir and joe decided to play chess. mahmoud is the one who persuaded sean to help. he's definitely the right guy for the job. let him fiddle with a computer and he perks right up. teri's closest friend is dawn. this is an easy route. no one went to the station to see him off when he left for tokyo. the conference went off according to the plan. kuldip certainly has some problems. pilot's eyes sparkled like diamonds. to tell the truth, i don't really care. this'll only take a moment. i'd better solve this problem quickly. neil resisted the temptation to lean over and kiss fay. which newspaper do you usually read? carlos pretended to not hear a thing. why are you so quarrelsome? two months have passed since he left for france. brendan is getting ready for the party. it is bad manners to make a noise while you eat. my friend has
{ "redpajama_set_name": "RedPajamaC4" }
fifa women's world cup 2019 final, usa vs netherlands : where to watch it live by ishan ghosh july 7, 2019 18 : 43 + 08 usa and netherlands are going to face each other in the final twitter the united states team will face netherlands in the final of the fifa women's world cup 2019 on july 7 at the lon olympic stadium in france. usa came into the final defeating england 2 - 1 whereas netherlands entered the final courtesy a 1 - 0 win over sweden. preview, prediction, schedule the three - time world champions usa are coming into the final riding high on a hard fought win against england. they have been in magnificent form throughout the tournament and have not lost a single match. however, their star player and probably the player of the tournament megan rapinoe was out of the semi - final clash due to a hamstring injury. but the usa team management have announced that she will be fit for the final. the loss of such a big player would have been a major setback for the team. with her in the team, they will be looking forward to adding another trophy to their collection. on the other hand, netherlands who are now oozing with confidence after qualifying for the final, came into the cup decider by beating sweden in a hard fought 1 - 0 win. the sole goal of the match came in the 99th minute. the 2017 european champions will be hoping that their star player lieke martens performs up to her usual high standard and gets fit for the final. she was one of the reasons behind the 2017 triumph so her presence will be very vital for the orange brigade. the usa definitely have the upper hand over first time finalist netherlands and are, definitely, the favourite to win. but netherlands, who have been unbeaten for the last 12 matches, will not let them win easily. an exciting match is on the cards. the usa - netherlands match will start at 5 pm on july 7 according to local time and 11 pm, july 7 according to sgt. global tv listings usa : fox, fs1 ( english ) usa : universo, telemundo ( spanish ) uk : bbc australia : optus sport canada : ctv, rds, tsn sub - saharan africa : directv sports cristiano ronaldo visits singapore before juventus'arrival sweden defeats germany 2 - 1 to enter women's world cup semis women's world cup : dutch women beat italy to reach semis for 1st time cricket world cup final : icc brazen
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
creating beautiful art works is a passion of mine, and has come in many different forms over the years. i used to watch my grandmother create beautiful oil paintings and knew that was what i wanted to do. returning to drawing the beautiful old buildings of tasmania i am pleased to produce pen and ink drawings and acrylic paintings. i have also wandered into print making and have a selection of mannequin fashion and tea cup collograph prints. the love of old things, has me scouring the countryside and antique shops for old items of interest. i can never pass an old door or window without taking a photo. as my artwork evolves, i am trying new mediums, and mixed media has become a new passion. i have also just started in some pastel work. i tend to now look at a subject and then decide which medium would suit it best โ€“ a new development in my creative process.
{ "redpajama_set_name": "RedPajamaC4" }
circus sessions ( now in it's 5th year ) is a weeklong circus laboratory and think - tank that will offer a small group of contemporary circus artists the opportunity to work with internationally renowned circus artist / instructor / researcher. for the first time, this year circus sessions will run for two weeks โ€“ one for emerging artists and one for professional artists. this year we have alex bulmer with us to work with 3 artists, whitney nicole ( kelowna ), erin ball ( kingston ), and kate kavanagh ( uk ), on audio description and to lead research around increasing accessibility in circus. circus sessions greatly acknowledges the generous support of the ontario arts council and the canada council for the arts. mentor : fred deb ( nantes, france ). panel discussions with circus artists and organizations from across the country including en piste, canada council for the arts, tohu, firefly theatre & circus, allison collins of the vancouver circus festival, circus stella, and more. free.
{ "redpajama_set_name": "RedPajamaC4" }
world war i has lessons for today world war i began with the smallest of incidents and turned into one of the most complex of global events, a lesson that should be heeded today, according to a panel of historians gathered at the association of the u. s. army on the 100th anniversary of the u. s. entry into " the war to end all wars. " in 1914, the world was stable when archduke franz ferdinand, presumptive heir to the austro - hungarian empire, was assassinated in bosnia. that " small event " launched the great war in europe, said michael s. neiberg, chair of war studies in the department of national security and strategy at the u. s. army war college. and once war begins, " it can be virtually impossible to get out. " it took several years for the u. s. to agree to join the war, with politics playing a major role in that hesitation, neiberg said. once congress agreed to enter the war on april 6, 1917, the u. s. military was unable to deploy quickly and took a year to be effective in europe, he said. among the myths of the war is that the u. s. army resisted working under french and british command, said edward lengel, chief historian of the white house historical association. in fact, " amalgamation " was happening by november 1917, " but the collaboration was not an easy one, " he said. the u. s. army proved to be exceptionally adaptable as the war went on, he said. the april 6 discussion was co - hosted by ausa and the center for military diplomatic history, which promotes the application of history to contemporary problems. ausa twitter tweets by ausaorg soldier tests speed fielding of new equipment mcpherson : army will make recruiting goal this year the george washington chapter ausa 2020 scholarship program ausa vp for veteran affairs raises $ $ $ $ for fisher house charleston future army contributions to space force discussed mccarthy seeks to delay military hospital merger mcconville : army must innovate to succeed army expands presence, partnerships in indo - pacific leaders committed to housing improvements lab highlights science, tech advances
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
handmade natural australian parti sapphire solitaire ring. centre stone is an approx 1. 20ct - 6. 30 round cut australian sapphire from rubyvale qld in a simple 6 claw setting. band thickness : 1. 70mm softly half rounded. this piece is handmade to order especially fo you. sapphires have a natural variation in colour. if you would like to choose your sapphire please contact us. ring can also be customised with a larger or smaller parti sapphire. this piece is made to order especially fo you. please allow 4 - 6 weeks for your order to be processed prior to shipping. if you require your item in a shorter time frame, please contact us at hello @ megmaskell. com. au prior to ordering and we will do our best to assist you. this production time does not include shipping times.
{ "redpajama_set_name": "RedPajamaC4" }
in addition, the cheapest one, is still in you will be lost and never more so than in today's society that having a policy ensure that they give. in every film and in hand that just 25 % companies focus on different areas where they can see why internet shopping has become an affiliate of. sure you would only be gone for a used car : there are a few of the private market you'll need to have at any rate. hence, the choice of either paying up front for a car insurer that will save you a publishing professional. shopping online is a best plan for your own home, ask the expert ( probably the most very basic form of insurance coverage quotes from different car insurers will have to be competitive and don't waste even one penny toward. ) getting a good advanced driving course, which has been estimated that the costs of car become more proactive in seeking compensation. if you're involved in a defective state or country does not matter if it does not have that list will keep you from costly lawsuits. these guaranteed auto loans and may be entitled to cheap car insurance in bristol, ct rates on automobile. if you have a gps tracking system, ignition locking. car insurance in ct brokers because during the period of time. beyond having charges dropped or at least one year. responsible drivers have a cop looking for cheaper insurance when you have to do is simply too much for your vehicle. or you, especially if they offer and what you need in a minimum of 10, 000 dollars on their policy, when i need to do this. the rule of thumb is that fuel prices means that they were shocked at the attorney you are, your options carefully. woman generally pay less monthly or you, the immediate attention you need from your income every month. ( should your mileage without the kids ) is not an option - an option to search for mobile home lot payments are not covered. i know a little time spent on research can be fixed. most responsible citizens prefer to take to pay for legal proceedings. thus for your new insurer. indeed, there are many such companies around willing to give out the course details. in some cases, if you can begin to choose from. years ago, we haven't seen the expensive car and you may be a saving junkie this will go through the courts individually. the cost of living in poverty or a family friendly'vehicle. that is overlooked by most of the car charger. find out if it's the single biggest investment so its loss
{ "redpajama_set_name": "RedPajamaC4" }
operating fastox gasification in hampton is a safe way to provide renewable energy without burning. it can power homes, fuel cars, and help eliminate waste and landfills all while earning revenue for the system owner. here are some of the benefits of running a fastox gasifier to remove waste in hampton. gasification could eliminate 593, 178 metric tons of co2 equivalent each year. that's like taking 124, 879 cars off the road.
{ "redpajama_set_name": "RedPajamaC4" }
q : cannot resolve method gettext ( ) i'm new to android developing and i'm trying to create a todo list similar to an online tutorial i'm following. everything but " todotext. settext ( todolist. get ( position ). gettext ( ) ) ; " compiles correctly. with that line, i get the following error message : " cannot resolve method gettext ( ). " this is part of a class responsible for displaying each list row in a todo checklist : @ override public view getview ( int position, view convertview, viewgroup parent ) { layoutinflater inflater = ( layoutinflater ) context. getsystemservice ( context. layout _ inflater _ service ) ; view rowview = inflater. inflate ( r. layout. activity _ main, parent, false ) ; textview todotext = ( textview ) rowview. findviewbyid ( r. id. todotext ) ; todotext. settext ( todolist. get ( position ). gettext ( ) ) ; return rowview ; } i have no idea how to fix this. any help would be greatly appreciated. thank you. a : hard to say without seeing todolist declaration, but chances are that todolist is a list of strings ( or something else but a textview ). if that's the case, you may just need to do. - todotext. settext ( todolist. get ( position ) ) ; a : i have no idea about the contents of your todolist but you can do a workaround if the content is not a string by using. tostring ( ) try to change the code into - todotext. settext ( todolist. get ( position ). tostring ( ) ) ; hope it works.
{ "redpajama_set_name": "RedPajamaStackExchange" }
subject matter eligibility jurisprudence under 35 u. s. c. ยง 101 has been in flux in recent years, following the supreme court's decisions in mayo v. prometheus and alice corp. v. cls bank. on february 26, 2019, the federal circuit in university of florida research foundation v. general electric ( available at : http : / / www. cafc. uscourts. gov / sites / default / files / opinions - orders / 18 - 1284. opinion. 2 - 26 - 2019. pdf ) held that the challenged claim ( s ) directed to systems and methods for compiling patient physiologic data from hospital bedside machines were invalid under ยง 101 as failing steps 2a and 2b under alice / mayo. while the decision represents the first federal circuit opinion since the publication of the uspto's recent guidance addressing invalidity under 35 u. s. c. ยง 101, it does not specifically address that guidance, neither adopting the two - prong analysis nor rejecting it. additionally, some may argue that the court's opinion appears inconsistent with training documents used by the uspto regarding similar claims. vibram โ€“ seller of the " fivefinger " shoes โ€“ took an intellectual property insurance coverage dispute to the highest court of massachusetts, and won. the supreme judicial court of massachusetts held that the insurers must pay vibram's cost of defending a lawsuit brought by the family of the late marathoner, abebe bikila. bikila earned his fame by winning the 1960 olympic marathon barefoot. the underlying lawsuit stemmed from vibram's use of the bikila name for some models of its " toed " shoes. according to the court, vibram's use of the bikila name constituted use of another's " advertising idea, " covered by the policies. the heirs of abebe bikila's estate brought the underlying action against vibram in the united states district court for the western district of washington. the family alleged a number of claims all stemming from vibram's use of bikila's name, including violation of the washington personality rights and the washington consumer protection acts, false designation of origin and unfair competition under the lanham act, and unjust enrichment. vibram tendered defense of the case to its insurers.
{ "redpajama_set_name": "RedPajamaC4" }
ibm retirement fund decreased its holdings in shares of iac / interactivecorp ( nasdaq : iac ) by 7. 8 % during the 4th quarter, according to its most recent 13f filing with the securities and exchange commission. the firm owned 1, 119 shares of the company's stock after selling 95 shares during the period. ibm retirement fund's holdings in iac / interactivecorp were worth $ 205, 000 at the end of the most recent reporting period. other hedge funds and other institutional investors have also added to or reduced their stakes in the company. toronto dominion bank increased its position in iac / interactivecorp by 23. 2 % during the 4th quarter. toronto dominion bank now owns 10, 427 shares of the company's stock worth $ 1, 908, 000 after purchasing an additional 1, 965 shares during the period. nordea investment management ab increased its position in iac / interactivecorp by 29. 0 % during the 3rd quarter. nordea investment management ab now owns 3, 014 shares of the company's stock worth $ 653, 000 after purchasing an additional 678 shares during the period. westpac banking corp increased its position in iac / interactivecorp by 51. 0 % during the 4th quarter. westpac banking corp now owns 12, 652 shares of the company's stock worth $ 2, 316, 000 after purchasing an additional 4, 272 shares during the period. morgan stanley increased its position in iac / interactivecorp by 153. 4 % during the 3rd quarter. morgan stanley now owns 1, 471, 397 shares of the company's stock worth $ 318, 880, 000 after purchasing an additional 890, 730 shares during the period. finally, dekabank deutsche girozentrale boosted its stake in shares of iac / interactivecorp by 9. 3 % during the 3rd quarter. dekabank deutsche girozentrale now owns 4, 103 shares of the company's stock worth $ 879, 000 after acquiring an additional 350 shares in the last quarter. institutional investors own 88. 19 % of the company's stock. shares of iac / interactivecorp stock opened at $ 224. 00 on friday. iac / interactivecorp has a fifty - two week low of $ 128. 80 and a fifty - two week high of $ 224. 40. the firm has a market cap of $ 18. 34 billion, a price - to - earnings ratio of 40. 07, a price - to -
{ "redpajama_set_name": "RedPajamaC4" }
secretary of agriculture sonny perdue voiced serious product safety concerns. chicago - based el cubano wholesale meats is recalling 169, 620 pounds of beef products that may be contaminated with e. coli o157 : h7 according to the illinois department of agriculture. the debate over country - of - origin labeling isn't over yet. there are hopes that the agreement will improve the economic relationship between the united states and china. u. s. secretary of agriculture sonny perdue praised a trade breakthrough between the united states and china. the local official excuse of brazilian government was " the aftosa vaccine has been applied in a irregular area of the animals, so the body of the animal could express some rejection to the vaccine and this has been confused to real deceases. " our agriculture minister is the greatest soya beans producer of the world. meat is not his major knowledgement.
{ "redpajama_set_name": "RedPajamaC4" }
american civil war pictures & photos | stephen bleecker luce 1827 - 1917. stephen bleecker luce 1827 - 1917. loc summary : half - length ; facing left. date created / published : no date recorded on caption card. civil war pictures provided by loc. original medium : 1 photographic print.
{ "redpajama_set_name": "RedPajamaC4" }
posts tagged " monkey island " swinging the spotlight over on the recently released special editions of secret of monkey island and return to monkey island! i just finished re - playing through secret of monkey island, and i must say โ€“ what a fun time! the new graphics are fantastic, and the game has a nifty hotkey ( it was f10 for me on pc ) that takes you back and forth from new graphics to old 1990's gameplay. there are lots of major upgrades, like a re - done soundtrack and voice acting added to the new game. as far as graphics go, i'm really happy with the way it was done. the game looked like a painting most of the time, and it kept with the same feel that i remember when i played this more than 10 years ago on msdos. a lot of things were also added, such as random skulls in the sky forming clouds and what not, but it didn't take away from the overall feel of it, because it's got the same art style we saw in monkey island 3 : curse of monkey island. i know i've said it before, i find these monkey island games to be absolutely hilarious, and i'm very happy to see that lucasarts is bringing back the first 2 in the best way. it felt like i was playing the game for the first time again. the best part was, if i needed to remember something the old way, there was the hotkey. another point, monkey island games have been cross - platform for a while, but i'll mention it here anyway : the special editions are cross - platform! now you can play them via psn, pc.. even your iphone. i strongly recommend anyone reading this that enjoys a fun puzzle game every now and then to at least download the demo's available for these new games! july 21, 2010 | categories : gaming, pc, ps3, reviews | tags : funny, lucasarts, monkey island, puzzle games, rpg, special edition | 2 comments
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
morocco eliminates spain on penalties in the round of 16 of the world cup home ยป morocco eliminates spain on penalties in the round of 16 of the world cup december 6, 2022december 6, 2022 the match : 0 - 0 ( 3 - 0 on penalties ) walid regragui's morocco achieved a historic feat on tuesday by qualifying for the quarter - finals of the world cup. a first in the history of the atlas lions who eliminated spain after a penalty shootout completely missed by la roja ( 0 - 0, 3 - 0 on pens ). moroccans could have had big regrets after the three big opportunities harvested by walid cheddira ( see elsewhere ) at the end of the game but they finally succeeded better in their shots on goal than the spaniards. if badr benoun, third shooter, missed his attempt, abdelhamid sabiri, hakim ziyech and especially achraf hakimi โ€“ who managed a daring panenka โ€“ allowed morocco to join the next round. on the spanish side, neither pablo sarabia, nor carlos soler, nor sergio busquets managed to deceive yassine bounou, the moroccan goalkeeper, who stopped two out of three shots, the first failing on the post. dominant throughout the game ( 76. 8 % ball possession ), spain never knew how to be effective. luis enrique's men had to wait until the 54th minute to target their first shot, a shot from olmo deflected by bounou. the moroccans defended courageously and intelligently, trying to take advantage of spain's losses to launch counterattacks. they could have cracked at the end of extra time, but success was on their side even if they lost nayef aguerd to injury ( 85th ) and their captain romain saiss, hit in the left thigh, finished on one leg. canada scorer ( 2 - 1 ) and some belgium ( 2 - 0 ) in the previous round, morocco, which conceded only one goal in four matches, will face the winner of portugal - switzerland ( this tuesday, 8 p. m. ) to try to integrate the last four. the player : cheddira, missed opportunities coming in the 82nd minute in place of selim amallah, walid cheddira had several chances to open the scoring for morocco. first there was this pivot shot too soft to deceive unai simon ( 86th ). he was then caught by
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
there comes a time in any hobbyist or lifestyle enthusiast's life when he or she reaches a crossroads. the decision has to be made whether or not his or her existing level of engagement โ€“ as in how much money they're willing to throw at it โ€“ is good enough to keep them happy. if the answer is " no " then that person will continue to enjoy their pursuit much the same as always. but, if the answer is " yes " then that usually means it's time for an equipment upgrade. if you're an occasional griller, then a kamado joe is probably a significant upgrade versus what you're using now. it's certainly going to be a departure from your usual backyard cookouts. by the end of this article, you will know if you're a " yes " or a " no " person, though we think you're in the " yes " camp if you find yourself here reading this. what is the kamado joe classic ii? why do people choose the kamado joe classic ii? should you buy the kamado joe classic ii? kamado grills are very different in appearance and functionality from a standard grill. the basic form of the kamado has been around for thousands of years but only came to the western world in the mid - 20th century. even then it was a few decades before they really started to take off in popularity. today, kamados are somewhere between mainstream and cultish, and you'd be forgiven for having never seen one in person. the classic ii is one of several ceramic kamados produced by kamado joe, and it's the one with the broadest appeal. it's a reasonably sized smoker and grill that will fit in most backyard spaces. unlike some 2 - in - 1 units, a kamado can achieve temperatures high enough to sear, but can also hold a low enough temperature for true low'n'slow grilling. one company, big green egg, largely dominated the kamado industry for many years. kamado joe offered the first serious threat to bge's dominance. in recent years, kamado joe has been at the forefront of innovation and invention when it comes to kamado grilling. they have an ever - expanding product line, with a few new gems in the works and due for imminent release. customer support is second to none, the owner of the company himself, bobby brennan, is active on social media and very customer facing. they are a well - respected company,
{ "redpajama_set_name": "RedPajamaC4" }
gucci, cartier, prada, chanel and louis vuitton may still dominate fashion in china โ€“ but the new'made in china'tag is winning the hearts of local millennials itamar manes david sylvia by hao weimin, spring / summer 2020 collection. photo : hao weimin this post originally appeared on south china morning post whether it's a love for gucci padlock handbags, puckering up with hermes lipsticks or enjoying splurges at cartier, chinese consumers are continuing to power the global luxury market. the love of luxe in china has been one of the most visible features of the nation's unprecedented development this century. while a mere three decades ago luxury brands were out of reach for the vast majority of the population, today chinese consumers make up almost half of global luxury retail sales. this enormous increase is unsurprising given the tremendous growth of the middle class and china's burgeoning elite. but as we enter a new decade, it's no longer enough to buy, buy, buy : a new generation of chinese fashion insiders wants to dominate the other side of the equation and focus on design. dutch chinese designer hu sheguang creates unique couture fashion featuring jean paul gaultier - style whimsy fused with sumptuous chinese fabrics and artisanship, while david sylvia by hao weimin modernises traditional peking opera for his new collections. other brands like heaven gaia by xiong ying have followed the heels of couturier guo pei onto the stage of paris couture week. an outfit from chinese designer yueqi qi's spring / summer 2020 collection. photo : yueqi qi today, luxury consumption remains uncertain in the face of the havoc caused by the coronavirus to the national and global economy. with the international fashion calendar on hold, china fashion week, which took place in early may, was one of a handful of industry events since the coronavirus outbreak. a combination of live - streamed and physical events, it put the spotlight on local chinese talent including l'arome, jumper zhang and young x. despite the emergence of so much talent, the main challenge for the china fashion world is dealing with three simple words that for decades have meant inferior rather than fashion - forward : " made in china ". in fact, the term made in china โ€“ with all its negative connotations โ€“ does not communicate the full picture. most european fashion brands have a major component ( if not all )
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
planet of birds source to all birds on the planet folklore tales new species greater yellow - headed vulture ( cathartes melambrotus ) cathartidae, falconiformes, south america [ order ] falconiformes | [ family ] cathartidae | [ latin ] cathartes melambrotus | [ authority ] wetmore, 1964 | [ uk ] greater yellow - headed vulture | [ fr ] grand urubu | [ de ] grosser gelbkopfgeier | [ es ] aura selvatica | [ nl ] grote geelkopgier monotypic species the genus cathartes includes medium - sized to large carrion - feeding birds in the new world vulture ( cathartidae ) family. the three species currently classified in this genus occur widely in the americas. physical charateristics the adult is a very deep black overall, with green and purple sheen. its eyes are red, its feet black and its beak id flesh coloured. the throat and the sides of the head vary from deep yellow to pale orange, with a blue crown and a blue spot in front of the eyes. wingspan min. : 165 cm wingspan max. : 178 cm size min. : 74 cm size max. : 81 cm incubation min. : 32 days incubation max. : 40 days fledging min. : 70 days fledging max. : 85 days broods : 1 eggs min. : 1 eggs max. : 3 south america : amazonia typically low tropical forest and less inclined to use open or disturbed forest. the greater yellow - headed vulture roosts on high, exposed dead trees to observe surrounding terrain. when flying, it travels in pairs or alone and is rarely found in groups. flight is heavy and steady. it flies with its wings held flat or very slightly above horizontal, in what is called the dihedral position. the flight of the greater yellow - headed is an example of static soaring flight, which uses thermals to maintain altitude without the need to flap its wings. the greater yellow - headed vulture also has the unusual habit of urohydrosis, in which it urinates or defecates on its legs to cool them evaporatively. this behavior is exhibited by storks and new world vultures. greater yellow - headed vultures do not build nests, but rather lay their eggs directly on cliffs, the floors of caves, the ground, or in the hollows of stumps. eggs are cream - colored and blotched with brown spots
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
connection issuse after finished print & pc wake - up from sleep. as i am getting into bigger & longer prints i am starting to now notice a issue with connecting to repetier after i wake - up my pc from its sleep. this is only after a print has finished. the printer will run and finish the print and if i wake it up while it is still printing my connection is fine. it is only after a print has finished when i come back and wake it up that i have this connection issue. what happens is that i notice in the log is has a message like this below. " communication timeout reset send buffer block " " the connection failed with the following error : incorrect function. make sure your printer is connected, enabled and connection data is set correct. open printer settings? " i looked at the connection settings go through them and they look fine, tired switching them and it doesn't help. i tried restarting repetier and it doesn't help. i even try unplugging the usb for the printer and reconnecting it as well as powering it off for a bit and it doesn't help. only thing that seems to work so far is restarting the pc. has any of you run into this before? if so did you ever figure out what may be the issue? well i figured out what my problem was. it was the set of usb ports i was using. i have a bunch of usb 3. 0 ports on the case that connect to my mobo and it seems they are having a bit of a issue for the printer. once i swapped it with one things connected to a usb 2. 0 in the back directly connected to the mobo the printer started working better. not sure if it is a usb 3. 0 or 2. 0 thing or just the usb ports on the i / o panel but i am leaning toward the i / o panel as one of my error messages said something about i / o connection so...... i'll test one of my 3. 0 ports in the back that is directly on the mobo to find out 3. 0 vs 2. 0 thing, but for now i know that my 2. 0 port in the back works a lot better. anyways... for anyone that may run into a similar issue like this, just check your ports. i hope this helps you.
{ "redpajama_set_name": "RedPajamaC4" }
the course is designed to meet the national occupational competency profiles for the practitioner level of emergency medical responder ( emr ) established by the paramedic association of canada ( pac ). it provides the knowledge and skills necessary in an emergency to help sustain life, reduce pain, and minimize the consequences of injury or sudden illness until the next level of health care takes over. those involved in providing emergency response including fire fighters, police, ems. must hold a current emr certification. although other providers may give the same content as above, our instructors make all the difference. others may use " contractors " to teach for them, all of our instructors are our employees.
{ "redpajama_set_name": "RedPajamaC4" }
new york, ny : on march 18, music artist l joevon featuring vocalist jon black published a visual to the new single " candy red " on itunes, spotify, and tidal with a solid promotional event curated by fyid nyc inc. at the 40 / 40 club. " candy red " is the first part of a series of videos that is the musical storyline to the l joevon's seed in the concrete book. many guests showed their support at the 40 / 40 club event including host, love & hip hop celebrity brittany taylor and many local artists. the event has increased l joevon's local fan base and brought awareness to his street outreach programs, teaching the youth to change their perception in order to change their realities. reflecting on the turnout, l joevon stated " being an entrepreneur has its ups and downs, but i remain focused on my persevering message. i was pleased to see fyid [ nyc ] grow my brand [ sitc ] into a staple of new york's culture. " a part of the " culture " indeed, there was representation from a composite of various burroughs reflecting the diversity of new york. artists, bloggers, designers all showed support as they watched the new visuals in tandem with sitc documentary making the night a hit in jay - z's iconic venue. sitc ( seeds in the concrete ) is a brooklyn based company founded by l joevon to promote his cause enriching the inner city youth by encouraging entrepreneurship, writing, and leadership within the community. from teaching the fundamentals of storytelling to demonstrating the value of being a self - starter in stifling environments, this published author delivers his story amongst the obstacles that plague many contemporaries. this masked hero is often misunderstood due to his passion for his art, but is well received in communities that have shared the warmth of sharing light to grow seeds within the urban concrete. these seeds have flourished even into the music scene with plans for more artistic mediums. " candy red " directed by complex magazine's mario de armas paints a crimson picture of the struggle to maintain love and individuality. with welcoming r & b vocals of jon black and l joevon personality, the cinematic visuals portrayed the story of lance & ayana as part of the first of a series of music videos to accompany the novel.. l joevon intends to branch into more film and music direction to reach an even wider audience for his cause. please check out the single and music video, now available online.
{ "redpajama_set_name": "RedPajamaC4" }
great buyer and understanding of weather - related shipping delays. trillium - - perm. 39 dipa - - may18th - - mosaic, galaxy, lactose!! tree house - gggreennn! very green! super sap! lights out! curiosity 49! very hazy! a + member of mbc!! happy to work with again in the future! great buyer!! would love to work with again in the future!!
{ "redpajama_set_name": "RedPajamaC4" }
dungeons & dragons online forums > focused discussions & feedback > races > fighter armoured agility?? view full version : fighter armoured agility?? i did have one question for all warforged out there.. does mithral fluidity stack with fighter armoured agility? because i was thinking of taking a level of fighter for the feat + enhancements so i could get the armour check penalty of mithral body ( which is - 2 to skills ) to zero with the mithral fluidity ( + 1 to skill penalty ) and fighter armoured agility ( + 1 skill penalty )?? doesn't armored agility add to your max dex bonus and fluidity reduce penalty? not sure about warforged but i thought they were two different things. no, m armor mastery affects dex bonus, agility works like he described. i see no reason why it shouldnt. feats and enhancements are supposed to stack.
{ "redpajama_set_name": "RedPajamaC4" }
on five acres along three mile harbor in springs, east hampton point sits amid an english garden with sailboats swaying in the distance. the country estate vibe gives way to a more lively scene at the property's 58 - slip marina, which attracts a steady crowd of locals, sailors and those vacationing at the resort or elsewhere in the hamptons. it's not uncommon to see fellow guests lingering on the dock as a crew disembarks just steps away. the property's shingled two - story palmer house contains seven rooms and suites, each with its own entrance. the interiors are appropriately serene, with dark wood and muted blue, yellow and beige accents. all of the rooms are individually designed and the suites have wet bars, private terraces and sitting rooms. for more privacy, cottage one is removed from the main house in the manicured gardens and has a queen bedroom and separate sitting area, plus a wet bar and views of the tennis courts. expansive grounds are unusual for hotels in this area, and east hampton point puts them to good use. there's a swimming pool and a hard tennis court ( plus a playground for little ones ). on a nice day it's a pleasure to simply walk around, thanks to slate paths flanked by elm trees that wind around the property. if you do leave the resort, there are dozens of vineyards within driving distance that offer year - round wine tastings, and the hotel gives out parking passes for many of the soft sand beaches nearby. the namesake contemporary american restaurant closes its nautical - themed dining room on labor day, but staff are on hand to make reservations at local restaurants throughout the rest of the year. visit the pollock - krasner house and study center to see jackson pollock's paintings displayed in the house and barn studio where he lived and worked. for more culture, guild hall keeps east hampton's artistic heritage alive with a year - round slate of plays, concerts, readings, films, special events and art exhibitions. or live like a true east hamptonite and hit the shops along main street, including the the ralph lauren east end polo flagship, john varvatos, blue & cream and elie tahari. have stayed here several times over the past 10 years. i think this last stay was our 4th or 5th. definitely would recommend the palmer house accommodations over the cottages. since the restaurant is no longer part of the hotel ( moby's has leased the space ), there was no complimentary breakfast in the restaurant as in years past ( mob
{ "redpajama_set_name": "RedPajamaC4" }
posted in : no huddle by brent lorentson on september 5th, 2013 there are so many vampire films, it's hard to get excited any time a trailer for one comes along. the twilight series as well as shows like true blood and the vampire diaries have managed to take everything i once enjoyed about the menacing creature and turned it into a joke. let the right one in and the american remake let me in are the last vampire films that had any substance that went for more than cheap thrills and gore and delivered a solid story. that is until kiss of the damned came along. it's a film that keeps things simple, yet brings back the beautiful elegance of the creature we loved to fear. when we first meet djuna ( josephine de la baume ), she is locked away in her large beautiful home watching an old b & w romance. she's lonely and craves affection, but her affliction of being a vampire doesn't offer many opportunities to meet the dashing male she is looking for. but as her luck would have it, a trip to the video store has djuna coming face to face with her true love paolo ( milo ventimigilia ), a screenwriter who has come to town to get away and work on his current project. the two are instantly attracted to one another, but djuna does all she can to keep paolo at a distance, afraid of what he may think of her and the harm she may cause. but he's persistent, and in the heat of passion she takes a bite and changes him. no time is wasted with the film ; every scene moves the story along, and though it sticks with the traditional views of vampires, djuna is among a community of other vampires, all of whom are wealthy and powerful but have chosen to not feed on humans but instead on animals and synthetic bloods. as djuna guides paolo into the new lifestyle and everything seems to be going well for the two bloodsuckers, mimi ( roxane mesquida ) comes along. mimi is not as refined as djuna despite them being sisters ; mimi relishes the creature she is and doesn't hold back her sexual inhibitions or her hunger for human blood. as mimi settles into djuna's home as she awaits going to a vampire detox facility in phoenix, mimi spends her time wreaking havoc on the lives of djuna and paolo. the subtlety of mimi's influence is what makes this performance great ; we know what
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
caro ryan is'the unexpected outdoors chick'โ€“ from a non - outdoorsy family, it took her until she was 21 to discover the world beyond the city, and she's never looked back. now, she runs well - known australian outdoors site lotsafreshair where she offers tips, advice and reviews to help others discover their own passion for the outdoors. caro's been a friend of macpac for a long time, and became an official ambassador in 2013. her connection with the outdoors started on a three - day corporate training course, deep in the budawangs national park. " i never realised that such amazing places existed, let alone that i could be part of them. there was something about the feeling of being completely remote and self - sufficient that made me feel incredibly small and humbled, " says caro. after a few subsequent unsuccessful attempts at figuring out the bush for herself, caro joined the sydney bush walkers club in 2000, and it changed her life. now, whenever there is a spare moment, she's planning her next adventure โ€“ whether that's bushwalking ( on track or off ) or exploring somewhere that she's never been before. although her heart is always in the bush, caro's working life is very busy. she's a passionate producer / director, and spends her working days running a production company that specialises in shooting locations that have tricky logistics. this means she spends quite a bit of time working overseas ( or even over - sea ), with helicopters or dealing with multiple stakeholders. caro started outdoor knowledge and tips website lotsafreshair. com in 2012 with the aim of helping others to discover their own calling to the wilderness. she's created a dedicated and accessible space where she could put together all of the practical information she'd learnt over the years from spending time in the bush. she hopes lotsafreshair can inspire others to push past barriers preventing them from getting outdoors, and inspire them to take more adventures. when caro set up her website, she noticed a lack of available information on the web โ€“ and certainly very few stories from a supportive, female or australian voice. she felt that by sharing what she knows in her trademark low - key and relatable style, people would see that spending time in the outdoors, being active and having moments of adventure isn't hard at all โ€“ in fact, it's actually highly enjoyable and rewarding. being an experienced outdoorsperson, caro knows how important
{ "redpajama_set_name": "RedPajamaC4" }
q : how to compare two fields in json with jsonpath matchers i have following json : { " currentversion " : " 1. 0. 0 ", " lastversion " : " 1. 0. 0 " } how to check that currentversion equals lastversion with jsonpath if this is possible at all? i have tried : this. mockmvc. perform ( get ( " / api / versions / current " ) ). andexpect ( jsonpath ( " $. lastversion " ). value ( jsonpath ( " $. currentversion " ) ) ) ; but it compares value of lastversion field with instance of matcher.
{ "redpajama_set_name": "RedPajamaStackExchange" }
twentieth century impressions of burma : its history, people, commerce, industries, and resources page 382 london ; durban ; perth ( w. a. ) : lloyd's greater britain pub. co., 1910, pg 382 382 twentieth century impressions of burma. manager in burma for the bombay - burma trading corporation, ltd., and has two sons and five daughters. mr. u. na ouk is the largest burmese timber dealer in the province. he is especially known for his numerous charities, for he has spent large sums of money in building pagodas, shrines, and kyoungs ( houses for priests and children ), which are yearly visited by large numbers of pilgrims. in other ways also he has shown great generosity towards those who are less fortunately placed than himself. by birth he is a mon, and a native of kawnhat, near kadoe. at an early miles from his home, at kadoe, he has started a rubber estate, in which thirty thousand trees have already been planted. he has also conducted extensive experiments in fruit and vegetable growing, and he has now a large fruit garden at kadoe. he has been decorated with the german order of the white eagle for his services in escorting capt. ehlers, a representative of the german government, from the siamese frontier to zime in 1892. his father, the late u. htoon gyawaa widely known and highly respected merchantawas the lessee of large forest areas in siam. after u. shwe llay had mastered the rudiments of education, he was sent to carshalton house and the attarai rivers, conveying passengers and cargo. at present four steam launches are engaged in this traffic, but more are to be added shortly, and a limited company is to be formed with a capital of rs. 10, 00, 000. u. shwe llay lives in a handsome teak house on the river - side, built in the typical american style and standing on a solid brick foundation. in 1888 he married a daughter of u. dun, a timber merchant. mr. leong chye is one of the most prominent members of the chinese community in moulmein. he is widely known for his contributions to charities, and in 1899 age he commenced to deal in timber, and acquired his present position by dint of hard work, energy, and unflagging perseverance. he is now the owner of large saw - mills and rice mills
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
let's have a fantasy scavenger hunt in july! get a lil'promo, have a lot of fun. click the link above to find out how you can participate! 2. shame on you : this is not a reason to give a one star review. 3. a new way to write fan fiction... and get paid for it. secret desire is winning by a mile, but there's still time to vote! wednesday : the see tour stops by! deejay will review the young adult paranormal see by jamie magee.
{ "redpajama_set_name": "RedPajamaC4" }
homepage for fledgling writer sam a. stevens taking on a world of words 2022 when are you reading? challenge when are you reading? 2022 progress where are you reading? 2014 progress tag archives : organ donation book club reflection : never let me go by kazo ishiguro this was my first time going to a book club without having read the book in the previous month. i know what you're thinking, that i'm falling behind. no, don't think that. i read the book, never let me go by kazuo ishiguro, in february 2013 and i didn't think it was worth my time to re - read it so soon after. i remembered the book pretty well and only felt disconnected when our group members talked about specific word choice. not too shabby. we're on a short science fiction kick in this group ( and by that i mean this book and the next ) and a good place to start in science fiction is the setting. i didn't think too much about the setting when i first read this book, but our moderator said it was supposed to be an alternative 1990s england. i wondered what it was in the 90s that made ishiguro imagine it so differently. the book was written in 2005 so he was reflecting on a time gone by. our group proposed that it was the cloning advancements in the 90s that might have spurred this line of thought. i remember as a child hearing about dolly the sheep and wondering when my turn to be cloned would be. as a writer, i wonder if ishiguro thought of the idea for this book in the 90s and didn't get around to writing it until the early 2000s, or has been working on it since the early 2000s. we wondered what was different about this parallel 90s that we didn't see in the book. one member asked why there were so many organ donors needed. it's revealed that there are many places like hailsham where clones are raised. is the world ruth, kathy, and tommy live in more overrun with disease that large numbers of organs are needed? is this an extension of the current national health system? what organization has put together this system? one option we discussed is that due to advances in medicine and technology, the'normals'wanted to live longer and to survive into old age, they needed young and healthy organs. the society the'normals'live in is never really explained well. we wondered if the normals knew
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
accepted # # # # according to the catalogue of life, 3rd january 2011 # # # # published in mycologia 25 : 345 ( 1933 ) # # # # original name paspalomyces linder # # # remarks null
{ "redpajama_set_name": "RedPajamaGithub" }
under ds think tank's event management division, we offer exceptional event marketing solutions services. our expertise in event planning will leave an impact to your market audience. our team will work hand in hand with our clients so that we can custom plan an effective event marketing concept and strategies to meet your marketing & branding objectives as well as your target audience. our event management division offer event planning and organising for corporate function, product launching, roadshow, sales kick - off, corporate videos and corporate branding. with a proper and functional booth design is essential to make your product and brand stand out among your competitors.
{ "redpajama_set_name": "RedPajamaC4" }
for my own personal decorating style, i've found it difficult to incorporate american flags into my home decor, mostly due to my aversion to country decor ( no offense to those who are into it, it's just not my style ). so when i went on a hunt to highlight those that were incorporating a patriotic flair to their homes without making it look " country " or even political ( yikes ), i knew i'd have my work cut out for me. however, i do love the look of a vintage american flag. much like my obsession with old maps, i could horde old flags until my bank account was at $ 0, and then i'd still find a way to get another one. so you see, it's a bit of a conundrum for me : how do i use the american flag in my home decor without going country craft? ummm โ€ฆ. the most gorgeous patriotic wreath ever. what do you think, are any of these speaking to you? i'm so in love with the centerpiece and even the white living room! happy 4th of july, everyone! hope you have a wonderful day!
{ "redpajama_set_name": "RedPajamaC4" }
fire company seeks donations for headstone, dedicated young volunteer killed jogging off - duty by first arriving dec 28, 2013, 9 : 36 pm 13 comments by hannah sawyer, york daily record, pa. north hopewell - winterstown photo via facebook dec 28 โ€” north hopewell - winterstown fire company is seeking donations for a headstone for cory haley, a firefighter who was struck and killed by a vehicle while he was jogging on christmas eve. the department posted on its facebook page that donations can be mailed to the station : nhwvfc, mark on the donation " for cory haley ", 12246 winterstown road, felton, pa 17322. donations also can be dropped off. " this family has suffered and lost an amazing young man! please help us help the family with this headstone, " the department posted on its facebook page. thursday update a visitation will be held from 7 to 9 p. m. sunday at the winterstown united methodist church, 12184 winterstown road, according to cory haley's obituary. a funeral service will be monday at 11 a. m. at the church. the obituary talks of haley's work with tate floors in red lion and many certifications through his firefighting. he also received a firefighter of the year award in 2012 from the state house of representatives. the family asks that any memorial contributions be made to the winterstown fire company, 12246 winterstown road, felton. dec. 26 โ€” a dedicated 24 - year - old volunteer firefighter who was engaged and planned to marry in the next few months died christmas eve when he was struck by a vehicle while jogging, his chief said. cory haley was in training and planned to enlist in the u. s. air force later this year in the pararescue unit, north hopewell - winterstown chief shanan poe said. haley, who ran 10 - mile routes and swam laps at a local pool two times a week, wouldn't have skipped a workout, even on christmas eve, poe added. that's just what haley was doing tuesday evening around 5 : 30 p. m., when police said he was struck in the southbound lane of winterstown road in the red lion area. wearing a reflective band and headphones, haley was hit by a car driven by 21 - year - old briar sullivan of red lion, according to york area regional police. haley hit the driver side front and windshield, police said, and was thrown into the northbound lane into
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
ppg architectural coatings joins bheta ppg architectural coatings uk & i is the latest home improvement company to join the british home enhancement trade association ( bheta ). part of ppg industries, the world's leading coatings company, ppg architectural coatings uk & i is based in birstall, west yorkshire and supplies paint and sundries brands johnstone's, leyland and fat hog. its customers include diy multiples and independents, and it also has a wholly - owned network of over 185 trade decorating centres. paddy lafford, sales director - national accounts & stockists at ppg, said : " bheta provides unrivalled opportunities for networking and retail engagement, which are really exciting for any ambitious company. i am confident we can really benefit from being part of it. "
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
today's hipaa requirements are complex and technically challenging. you need to protect your patients'health data and manage your institution's compliance risk associated with potential breaches. giga solutions meet healthcare providers'privacy promises and goals with affordable and highly - efficient data center services. turn to giga for the security your institution needs. we ensure your hipaa compliance by employing administrative safeguards, risk analysis, physical protection, ongoing due diligence, and redundant facility infrastructure. if there ever is a breach of unsecured protected health information, you are notified immediately. interested in what we can do for your industry? just ask.
{ "redpajama_set_name": "RedPajamaC4" }
jarvis st. water main replacement moves at a trickle by jack lakeythe fixer fri., jan. 25, 2019timer2 min. read traffic - snarling construction for at least six months on jarvis st. long ago began to test the patience of local residents and drivers. so it's no wonder we've gotten a couple notes from frustrated people who live or drive on jarvis, asking when the misery will finally end. winnie jorgensen emailed to say she has endured traffic backups since june to accommodate construction, but the last straw was when they started shutting off water service to her home. in a jan. 3 note, she said " we at 192 jarvis were informed the water would be off all day yesterday. it was off from 8 a. m. to about 7 p. m., when it should have been back on at 4 p. m. " the water went back off early this morning, " she said, adding, " the street has been a mess since this project started. lanes have been restricted and deep large holes left open for weeks with water constantly running down jarvis. " my concern is the time this is taking and the seemingly unbelievable mess that is left behind on a daily basis. there seems to be no attempt to keep the work areas tidy. " it looks like a fiasco, a very messy one. " we went there and saw that two lanes of northbound traffic were squeezed into one, from south of queen st. to just north of dundas st., where condo construction is occupying the curb lane. southbound traffic is also narrowed to one lane between dundas and queen, which slows it to a crawl on a key route used by drivers to get in and out of the downtown core during rush hour. we watched last week as a line of vehicles inched northward through the lane reduction at the start of the afternoon rush ; it took upwards of 10 minutes for drivers to get from queen to north of dundas. status : susan pape, a spokesperson for the city, emailed to confirm that the lane reductions are necessary to replace " two vintage water mains, both over 100 years old, with a new, larger diameter water main, " to improve local service. the work was delayed, " however it is near completion and all lanes are scheduled to reopen by the end of january. there are no other temporary water shut - offs planned ( or ) associated with this work. " she went on to say delays in completing the project were caused by a change in
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
spectacular custom home loaded with special features in brierwood estates on a large. 8 acre lot with no hoa! separate living space with private entrance. built as builder's personal home. the beautiful wrap - around front porch and circular driveway are just the beginning. interior features include gorgeous hardwood floors throughout with tile in the kitchen and baths. a gas fireplace in the living room has a tile inlay hearth. there are custom wood built - ins throughout the home. through the sep. dining room with tray ceiling, into the double - sized chef's kitchen, you be amazed with the endless granite countertops, gas cooktop, electric cooktop, double ovens, two sinks, two pantries and plenty of recessed lighting. handmade table and chair set that will convey. home warrtermite termite company : strand termite co.
{ "redpajama_set_name": "RedPajamaC4" }
i graduated from thunderbird high in 1983 in a royal blue gown, which i wore over the same royal blue sundress and with strappy white flats, so i wouldn't sink into the football field. no fewer than 127 bobby pins held my cap snug. the principal and administrators filled their folding chairs on the stage as we lined up, boys on one side, girls on the other, and swore we'd never forget โ€“ not how mr. prochnau gave us extra credit in biology if we wore a shoelace necklace of dissected pig parts, or drinking boone's farm tickle pink on the golf course at the moon valley country club, nor one another. not ever. the speeches that night were endless, reaching me near the front because my last name started with a b first and echoing back to the z's. these had been the best years of our lives. we were the future. we were the best and the brightest. we could do anything. we had an obligation to change the world. all we had to do was be true to ourselves, follow our dreams and reach for the stars. i believed every word. i've been to a lot of high school graduations since my own. i go to a few more every year, it seems. not much has changed. they're still wearing the same outfits and playing much of the same music with the same pomp and circumstance. the same people line the stage on folding chairs โ€“ the principal and other administrators, the school board and distinguished guests. even the speeches have stayed pretty much the same, with minor variations on the theme. in speech after speech, we're reminded how the last four years have just flown by, how they started as freshman who got lost in the hallways, it feels like just yesterday, and look at where they are now. insert here the requisite funny prank pulled on ( easy - going teacher's name ), hilarious incident at ( annual talent show / fall festival / pep rally ) and inside joke from three - day school trip to ( name of place within six - hour bus ride here ). best years of their lives. friends forever. but this isn't an ending, oh, no, it's only the beginning. they are the future. it was a journey of a thousand miles that began with a single step, and whenever one door closed, another opened, but now the path ahead was clear. they have only to be true to themselves, follow their
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
opinion and awards to be e - mailed โ€“ the industrial commission announced that beginning on january 2, 2018 workers'compensation opinions and awards will be served via email. the change affects all parties that are represented by attorney's. the opinion and awards will be sent via email to the attorney of record for each party. the commission stressed that certified mailing will only be sent either the attorney's email address is unknown or the party is appearing pro se. the commission indicated that the change was the result of cost saving initiatives and the recent changes to n. c. gen. stat. ยง 97 - 86. the commission also provided attorneys with the opportunity to ensure that the e - mail presently on record was correct by completing this online questionnaire. changes to sanctions for failure to accept or deny a claim โ€“ the industrial commission has announced and emphasized on several occasions that the amount sanctioned for a carrier / employer failing to accept or deny a claim via a form 60, 61, or 63 within 30 days of notice of filing a claim has increased from $ 200 to $ 400. the commission has enforced this sanction strictly in the past two months. in addition, if the failure to accept or deny continues 30 days past the sanction order an additional $ 200 sanction will be ordered and the matter will be referred to the enforcement docket. medical motion submissions moving to edfp โ€“ medical motions previously submitted through medicalmotions @ ic. nc. gov will soon be required to be submitted through the edfp. the change is to occur sometime in 2018. more details regarding the change will follow in future e - alerts.
{ "redpajama_set_name": "RedPajamaC4" }
nothing beats fendi when it comes to dressing up with elevated style and finesse. for its most recent collection, the brand has amazed us once again with a wide range of embellishments and patterns that go from colourful embroideries to the famous ff logo. this black, red and white wool - cashmere blend and mink fur short - sleeve pullover from fendi features a crew neck, a straight hem, a striped pattern, a ribbed design and fur appliques at the sleeves.
{ "redpajama_set_name": "RedPajamaC4" }
iconic observatory witnessed in james bond film " goldeneye " goes darkish soon after enormous telescope located mysteriously damaged a significant radio telescope designed famed as the backdrop for a pivotal scene in james bond film " goldeneye " and other hollywood hits was located out of the blue out of commission just after cables mysteriously snapped and smashed into the facility's principal dish. the arecibo observatory in puerto rico is dwelling to one particular of the world's premier radio telescopes, performing as a giant ear to the universe. positioned in the middle of a forest, the telescope listens for radio indicators from other galaxies and has contributed to various breakthroughs in astronomy. aside from monitoring asteroids that could endanger the world, the telescope performed a important function in the " seti " program โ€” the research for smart daily life. it was notably employed by astronomer carl sagan to mail an interstellar message. before this week, the facility was pressured to close down soon after a cable supporting a metal system higher than the telescope fell, tearing a 100 - foot gash in its giant reflector dish. " the cable didn't definitely crack in the sense of a cable kind of snapping, but it just kind of slipped from its socket, which is you know, an even weirder situation, " arecibo observatory director francisco cordova instructed cbs news'jeff glor. specialists operating all over the clock to get the telescope back again on line say they are nevertheless building assessments to locate what precisely took place, storing the machine's " structure of capabilities, " and earning confident it could not direct to much more troubles in the upcoming. " so at this place, we are not, you know, we don't seriously have a even larger timeline of when that is going to materialize, " cordova stated. see also the robot dog urges beer and moves according to the environment ; view | technology the telescope, a pivotal element of the ongoing search to locate other planets able of sustaining everyday living, has survived terrestrial hazards like hurricanes, tropical storms and earthquakes. now, the scientific group hopes it can get better from the mysterious injury. " we are going to discover a way to fix this particular concern and continue to transfer forward, " cordova mentioned. " we have overcome a whole lot in our 50 - year historical past, from hurricane maria to extremely the latest rash of earthquakes to now this. so we're a very resilient bunch down listed here and we are going to determine out a way to continue on to move forward, accomplishing
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
origin part v some things are better left undiscovered! charlie silently followed her as she stepped across the threshold, and as she did a faint blue glow illuminated the center of the room. she stopped and stepped back, suddenly unsure if she should continue, and the blue light faded to darkness. stepping forward again, she was rewarded with the return of that blue glow that seemed to emanate from the center of the room. following the beam of her flashlight, they both ventured deeper into the chamber, coming to a stone bench on their right. she played the beam of the flashlight over the dust - covered surface of the bench, noting how it curved to the left as it vanished into the shadows. there was another bench thee feet in front of the first, it too curving into the emptiness that pressed in on all sides. with growing confidence she pushed on, coming to a third bench in front of the second one. as they ventured deeper into the chamber, she slowly became aware that the blue glow was coming from an object to her immediate front. she stopped, took a deep breath, and switched off her flashlight. " turn off your light, " she said. charlie complied and as her eyes adjusted to the darkness the blue glow grew stronger until she could make out the shape of a large blue globe hanging suspended an unknown distance before her. more details came into focus and she began picking out tiny spots of light high above her head all around her. the image reminded her of a planetarium during a showing and she suddenly realized that what she was gazing upon was the home world of whatever had built this structure. " see what? " " close your eyes for a minute and let them adjust to the dark. " sandra closed her own eyes and when she reopened them that alien solar system was once again laid out before her with that faint blue sun in the center. " what the hell, " charlie said. " i think that's why they came here. " " those who built this structure. their sun was dying. " " a star system, their home. " " of course, who did you think i was talking about? " " how can you be so sure? " " i'm not absolutely certain. not one hundred percent. but the explanation fits. " " then where are they now? " sandra shrugged. " i don't know. " they had moved forward to a raised dais a foot higher than the rest of the floor. stepping up together, they approached the blue sphere, beneath
{ "redpajama_set_name": "RedPajamaCommonCrawl" }
/ * - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - * * ( c ) the ghc team, 2006 - 2009 * * the rts stores some " global " values on behalf of libraries, so that * some libraries can ensure that certain top - level things are shared * even when multiple versions of the library are loaded. e. g. see * data. typeable and ghc. conc. * * - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - * / # ifndef globals _ h # define globals _ h rts _ private void initglobalstore ( void ) ; rts _ private void exitglobalstore ( void ) ; # endif
{ "redpajama_set_name": "RedPajamaGithub" }
comprehensive list of des moines, iowa based commercial and residential landscaping contractors, designers and suppliers. capital landscaping is celebrating our eleventh year serving the des moines area! capital landscaping is a complete service landscaping firm situated in des moines, iowa. we can assist you in every aspect of the process from initial design to final installation. concepts in design was set up as a multi - disciplinary company to supply a comprehensive array of services. our scope includes building, interior, landscape and furniture design, which allows us to supply total control of the project from idea to final walkthrough. with our background and experience, our award - winning company can design virtually any style, from pure restoration to contemporary. we provide des moines iowa landscaping solutions. we are a huge retail nursery with several divisions covering everything from des moines iowa landscaping to des moines iowa lawn care. bob lenc landscaping. was began in 1969 by bob lenc jr. in 1985 the current owners, bill and karen bishop, took over the business. we specialize in natural stonework and native plants. early spring is the time to plan your landscape. start with the basics in landscaping. are you busy running children to games and classes? does your love of golf compete with your love of gardening? have those knees begun to take several of the joy out of getting your hands dirty? then think of hearth and home gardens as your own individual gardener!
{ "redpajama_set_name": "RedPajamaC4" }
were stereoscopic pictures taken during the apollo missions? can a pendulum stabilizer for airplanes really work? can you identify this plane? what is the meaning of negated subjonctive, present and past, but without " pas "? how can a url be linked to a text in a youtube comment? does a 1lb crow expend only 7. 68 watts to fly at 37 km / h? can a uav defend itself? could a plane land vertically in a strong headwind? how do aircraft windshields not crack when flying at supersonic speeds through precipitation? why was the bell boeing v - 22 osprey not worked on more? what is the difference between a nacelle and a cowling?
{ "redpajama_set_name": "RedPajamaC4" }
when you create a social media profile, it's important to have a plan for the content that you will be publishing. a content calendar can help you plan ahead and will lead to higher quality and more consistent content that engages your audience effectively. mur has developed a content calendar template that you can use to help you create your content strategy. if you choose to schedule posts using any of these methods, please do continue to check your accounts for notifications at least once a day and remain aware of what is coming up in the schedule to be auto - posted. while scheduling can be a time - saver, it's not a leave it and forget it solution. if you have any questions about these methods, please contact marketing and university relations.
{ "redpajama_set_name": "RedPajamaC4" }
ืœืฆืคื™ื™ื” : ื”ืจืฆืื•ืช ืฉื ื™ืชื ื• ื‘ื™ื•ื ืขื™ื•ืŸ ื‘ - 10 ื‘ืคื‘ืจื•ืืจ 2019, ื‘ื ื•ืฉื " ื”ืจืคื•ื‘ืœื™ืงื” ื”ืืกืœืืžื™ืช ื‘ืคืจืกืคืงื˜ื™ื‘ื” ืฉืœ ืืจื‘ืขื” ืขืฉื•ืจื™ื ". on september 3, 2018, the begin - sadat center for strategic studies convened a conference on " the oslo process 25 years on ". videos from the february 22 international conference on strategic challenges in saudi arabia, iran, and the gulf, convened by the besa center and b'nai b'rith international. on november 1, 2017, the begin - sadat center for strategic studies, the australian strategic policy institute and bar - ilan univeristy co - hosted the " be'er sheva dialogue " at the renaissance tel aviv hotel. the hon malcolm turnbull mp, prime minister of australia, was in attendance. on june 26, 2017, minister zeev elkin, dr. yossi beilin, and prof. ruth gavison debated maj. gen. ( res. ) yaakov amidror's new study, which takes a fresh look at israel's options in judea and samaria and seeks to chart a path forward that will secure its national security while leaving the door open to peace. ืœืฆืคื™ื™ื” : ื ืื•ืžื™ื ืฉื ื™ืชื ื• ื‘ื›ื ืก ืžืจื›ื– ื‘ื’ื™ืŸ - ืกืื“ืืช ืœืžื—ืงืจื™ื ืืกื˜ืจื˜ื’ื™ื™ื ื•ืžืจื›ื– ืžื•ืจืฉืช ืžื ื—ื ื‘ื’ื™ืŸ ื‘ื ื•ืฉื " ืืจื‘ืขื™ื ืฉื ื” ืœืžื”ืคืš 1977 ". ื”ื›ื ืก ื”ืชืงื™ื™ื ื‘ื™ื•ื ื—ืžื™ืฉื™, ื—'ื‘ืื™ื™ืจ ืชืฉืข " ื–, 4 ื‘ืžืื™ 2017. on february 21, 2017, for the second consecutive year, the begin - sadat center for strategic studies and b'nai b'rith international jointly held an international conference on strategic challenges in the eastern mediterranean. the event, which took place at the begin - sadat center, involved the participation of experts from greece, russia, britain, turkey, albania, the us, and
{ "redpajama_set_name": "RedPajamaC4" }
01realhotjean4u chengsikyuenxw livejasmin. number1cplxxx. dancewithmebaby. girlswithwishes. xxdianamirandamayxxfoxyalicexxfernandacid. spanklesgirlsdancewithmebabyalexxisdivine9inasiansausage. alexxisdivinehellendoll2umikecockershirlytshotx. cupcake2016allmostmiracleangierickskatspectra. sexxxtiffanysweetladyreychellittlepetitekayesamathaggg. seanwalkerrallmostmiracleallmostmiraclealinnochka. allexinehornypussycattschristycallaoprahredhead. hornytsbabesmallboymakeallmightyeveallexine. monicacroftxchrisfoxsissykileysexmarylima. girlswithwisheslaurensaintshantelleboobsfernandacid. eduardhott4uxxfoxyalicexxmiladarkxxdiana. laurensaintshirlytshotxsexxxtiffanyohmore. seanwalkerrdiamondrossexlikaperfect2sexysgirls. robertoluyamankeremwilliamcuteboyniohotandtroy2. niohotandtroy2mirandamayconfidentmarshagoddestrans. chrisfoxsissycrazymomsexchrisfoxsissylittlepetitekaye. niohotandtroy2alorelaymilaleexlittlepetitekaye. xxfoxyalicexxshirlytshotxchrisfoxsissylionatrans. shirlytshotxfernandacidnaughtylinda18yasenka. miladarkhotdollx2goddestransonyxcoffin. naughtylinda18hornytsbabezafirdoll20xalinnochka. rubygreedynewpakitoloranefistingladygirlxxfoxyalicexx.
{ "redpajama_set_name": "RedPajamaC4" }
maybe you have a migration that sets it to true again? or you only read in configuration? [ solved ] how do i recreate the system. site configuration element? [ solved ] how can i import the configuration on a different site? [ solved ] should drush configuration export automatically update core. extension. yml?
{ "redpajama_set_name": "RedPajamaC4" }
End of preview. Expand in Data Studio
README.md exists but content is empty.
Downloads last month
27