|
--- |
|
datasets: |
|
- tattabio/OMG |
|
license: apache-2.0 |
|
--- |
|
|
|
# gLM2_650M |
|
|
|
gLM2 is a mixed-modality genomic language model, trained on the [`OMG Dataset`](https://huggingface.co/datasets/tattabio/OMG). |
|
The model encodes a genomic scaffold with both both amino-acid and DNA tokens. |
|
|
|
gLM2 is trained at two scales: 150M (available at [`tattabio/gLM2_150M`](https://huggingface.co/tattabio/gLM2_150M)) and 650M parameters. |
|
|
|
See [https://github.com/TattaBio/gLM2](https://github.com/TattaBio/gLM2) for inference scripts. |
|
|
|
### Model Description |
|
|
|
gLM2 is a transformer encoder trained with the masked language modeling objective. |
|
It encodes a genomic contig as a sequence of protein coding sequences (CDS) and DNA inter-genic sequences (IGS). |
|
CDS elements are tokenized using per-amino acid tokens, and IGS elements are tokenized using per-nucleotide tokens. |
|
|
|
|
|
- To encode the genomic strand, we prepended each genomic element with a special token, either `<+>` or `<->` to indicate the positive and negative strands. |
|
- To avoid collision between amino acid and nucleotide tokens, the tokenizer expects all amino acids to be uppercase, and all nucleotides to be lowercase. |
|
|
|
UPDATE(09/2024): We updated the model with longer context length (4096 tokens vs. 2048 tokens) and per-nucleotide IGS tokenization instead of BPE. |
|
|
|
## Getting Started |
|
|
|
|
|
```python |
|
import torch |
|
from transformers import AutoModel, AutoTokenizer |
|
|
|
model = AutoModel.from_pretrained('tattabio/gLM2_650M', torch_dtype=torch.bfloat16, trust_remote_code=True).cuda() |
|
tokenizer = AutoTokenizer.from_pretrained('tattabio/gLM2_650M', trust_remote_code=True) |
|
|
|
# A contig with two proteins and an inter-genic sequence. |
|
# NOTE: Nucleotides should always be lowercase, and prepended with `<+>`. |
|
sequence = "<+>MALTKVEKRNRIKRRVRGKISGTQASPRLSVYKSNK<+>aatttaaggaa<->MLGIDNIERVKPGGLELVDRLVAVNRVTKVTKGGRAFGFSAIVVVGNED" |
|
|
|
# Tokenize the sequence. |
|
encodings = tokenizer([sequence], return_tensors='pt') |
|
|
|
# Extract embeddings. |
|
with torch.no_grad(): |
|
embeddings = model(encodings.input_ids.cuda(), output_hidden_states=True).last_hidden_state |
|
|
|
``` |
|
|
|
### Training Data |
|
|
|
gLM2 is trained on the [`OMG`](https://huggingface.co/datasets/tattabio/OMG) dataset. |
|
To improve the dataset balance and remove near-duplicate examples, the data is tokenized and pruned by applying Semantic Deduplication [SemDedup](https://arxiv.org/abs/2303.09540). |
|
We use an embedding distance threshold of 2e-3, resulting in 49% of the dataset being pruned. |
|
|
|
## Training Details |
|
|
|
- Pretraining tokens: 315B |
|
- Context length: 4096 |
|
- Masking rate: 30% |
|
- Learning rate: 1e-3 |
|
- Optimizer: AdamW (betas = (0.9, 0.95)) |
|
- Mixed precision training: bfloat16 |
|
- Weight decay: 0.1 |
|
|
|
|
|
## Citation |
|
|
|
**BioRxiv:** |
|
[https://www.biorxiv.org/content/10.1101/2024.08.14.607850](https://www.biorxiv.org/content/10.1101/2024.08.14.607850) |
|
|
|
**BibTeX:** |
|
|
|
```@article {Cornman2024.08.14.607850, |
|
author = {Cornman, Andre and West-Roberts, Jacob and Camargo, Antonio Pedro and Roux, Simon and Beracochea, Martin and Mirdita, Milot and Ovchinnikov, Sergey and Hwang, Yunha}, |
|
title = {The OMG dataset: An Open MetaGenomic corpus for mixed-modality genomic language modeling}, |
|
elocation-id = {2024.08.14.607850}, |
|
year = {2024}, |
|
doi = {10.1101/2024.08.14.607850}, |
|
publisher = {Cold Spring Harbor Laboratory}, |
|
URL = {https://www.biorxiv.org/content/early/2024/08/17/2024.08.14.607850}, |
|
eprint = {https://www.biorxiv.org/content/early/2024/08/17/2024.08.14.607850.full.pdf}, |
|
journal = {bioRxiv} |
|
} |
|
|